(data stored in ACNUC7421 zone)

EMBL: CP000462.UBIA

CP000462.UBIA        Location/Qualifiers
FT   CDS_pept        196642..197505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="AHA_0181"
FT                   /product="4-hydroxybenzoate polyprenyl transferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="identified by match to protein family HMM PF01040;
FT                   match to protein family HMM TIGR01474"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37205"
FT                   /db_xref="GOA:A0KEP9"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEP9"
FT                   /protein_id="ABK37205.1"
FT                   /translation="MNLLTKERGLAYVQLARIDKPIGTLLLLWPTLWALWLAADGLPDL
FT                   WTLLVFVVGVFLMRSAGCVINDYADRNFDGHVKRTAGRPLPMGKVKPREVLALFAVLAL
FT                   ISFALVLTMNPLTIGLSFAALLLAVCYPFMKRYIPIPQLVLGMAFSWSIPMAYAAQANA
FT                   LPAVAWLVFLANLLWTIAYDTQYAMVDRDDDLKLGLKSSAILFGRHDKRIIGALQLLTL
FT                   LILLLVGQLSELGSSYYWSLLAAAALFVYQQRLIRERQREACFQAFLNNNYVGALIFAG
FT                   VVINYL"
     gtgaatctgt taaccaagga gcggggactg gcctacgtgc agttggcccg catcgacaag        60
     cccatcggca ccctgctact gctgtggccg accctgtggg cgctgtggct ggcggctgac       120
     ggcctgccgg atctctggac cctgctggtg ttcgtggtgg gggtgtttct gatgcgctcc       180
     gccggttgcg tcatcaacga ctatgcggat cgcaactttg acggtcacgt gaagcgcacc       240
     gccggccggc cgctgcccat gggcaaggtc aagccgcggg aggtgctggc gctgtttgcg       300
     gtgctggcgc tcatctcgtt cgccctggtg ctgaccatga acccgctcac catcggcctg       360
     tcgttcgcgg ccctgctgct ggcggtctgt taccccttca tgaagcgcta catcccgatc       420
     ccccagctgg tgctcggcat ggccttctcc tggtcgattc ccatggccta tgcggcccag       480
     gccaacgcct tgccagcggt ggcctggctg gtgtttctcg ccaacctgct gtggaccatc       540
     gcctacgaca cccagtacgc catggtggac cgggacgacg acctcaagct cggcctcaag       600
     tcgagcgcca tcctgttcgg ccgccacgac aagcggatca tcggcgcgct gcagctgctg       660
     accctgctga tcctgctgct ggtggggcag ctgagcgagc tgggttccag ctactactgg       720
     tcgctactgg cggcggcggc gctgttcgtc tatcagcagc ggctgatccg cgagcggcag       780
     cgggaggcct gcttccaggc gtttctcaac aacaactacg tgggggcgct gatctttgcc       840
     ggggtagtga tcaactatct gtga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page