(data stored in ACNUC7421 zone)

EMBL: CP000462.UVRD

CP000462.UVRD        Location/Qualifiers
FT   CDS_pept        241787..243958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="AHA_0220"
FT                   /product="DNA helicase II"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00580;
FT                   match to protein family HMM TIGR01075"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37514"
FT                   /db_xref="GOA:A0KET2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A0KET2"
FT                   /protein_id="ABK37514.1"
FT                   /translation="MDVSTLLDGLNDKQRDAVAAPRCNLLVLAGAGSGKTRVLVHRIAW
FT                   LMQVERCSPFSIIAVTFTNKAAAEMRGRVEKVIGDGVRGMWIGTFHGIAHRLLRAHHLD
FT                   AGLPQDFQILDSDDQYRLIRRVLKALNLDEKHWAPRAVMGYINGKKDEGLRPGDIDLYG
FT                   DPVTRTYQQIYKTYQETCDRSGLVDFAELLLRAHELWLNKPHILEHYRDRFQNILVDEF
FT                   QDTNGIQYAWLRMLAGDTGKVMIVGDDDQSIYGWRGAKIENIQRFLTDYQGAETIRLEQ
FT                   NYRSTANILKAANCVIANNAERLGKELWTEGAEGEPISLYAAFNEVDEARFVVGRLKDW
FT                   KEKGGLLADCAILYRSNAQSRVLEEALMQDAMPYRIYGGLRFFERQEIKDAMAYLRLIN
FT                   NRGDDASFERVVNTPTRGIGDRTLEILRNNARDQGQNLWQSAKALLGDKVLTGRAGNAV
FT                   RGFVDLIDALEEQVSLLPLHQQADIAIQHSGLKAMYLAEKGEKSQARVENLDELVTACR
FT                   QYQRPDELEDMSDLSAFLAHAALESGENQADEYADAVQLMTLHSAKGLEFPLVLLVGVE
FT                   EGMFPSQQSTEESGRLEEERRLCYVGMTRAMEKLYICYAESRRIYGREMFHKPSRFIRE
FT                   MPAECLEEIRLRTQVSRPTQYGRFSQNEVQQSFDASGIKLGQRVLHPKFGEGIVLNFEG
FT                   VGQQSRVQIQFDDVGAKWLVTAYARLETL"
     atggacgttt caaccctgct cgacgggctc aatgacaagc aaagagacgc ggtggcggcc        60
     ccccgttgca acctgctggt gctggccggt gccggttcgg gcaagacccg ggtgctggtg       120
     caccgtatcg cctggctgat gcaggtggaa cgctgttcac ccttctccat catcgcggtg       180
     acctttacca acaaggcggc ggccgagatg cgcggccggg tcgagaaggt gatcggtgac       240
     ggcgtgcgcg gcatgtggat cggtaccttc cacggcatcg cccaccgcct gctgcgggcc       300
     caccatctgg atgcggggct gccgcaggat ttccagatcc tcgactccga cgaccagtac       360
     cggctcatcc gccgggtgct caaggcgctc aacctcgacg agaagcactg ggccccgcgc       420
     gccgtgatgg gctatatcaa cggcaagaag gacgaggggc tgcgccccgg cgacatcgac       480
     ctctacggcg atcccgtcac ccgcacctat cagcagatct acaagaccta tcaggagacc       540
     tgcgatcgct ccgggctggt ggattttgcc gagctgctgc tgcgcgccca cgagctgtgg       600
     ctgaacaagc cgcacatcct cgagcactac cgcgatcgct tccagaacat cctggtggac       660
     gagttccagg ataccaacgg catccagtac gcctggctgc ggatgctggc cggcgacacc       720
     ggcaaggtga tgatcgtcgg cgacgatgac cagtccatct acggctggcg cggcgccaag       780
     atcgagaaca tccagcgctt cctgaccgac tatcaagggg ccgagaccat ccgcctcgag       840
     cagaactacc gctccaccgc caacatcctg aaagcggcca actgcgtcat cgccaacaac       900
     gccgagcgcc ttggcaagga gctgtggacc gagggcgccg agggcgagcc gatttcgctg       960
     tacgccgcct tcaacgaggt ggacgaggcc cgcttcgtgg ttggccgcct caaggactgg      1020
     aaagagaagg gcggcttgct cgccgactgc gccatcctct atcgctccaa cgcccagtcg      1080
     cgggtgctgg aagaggcgct gatgcaggac gccatgccgt accgcatcta tggcggcctg      1140
     cgcttcttcg agcgccagga aatcaaggac gccatggcgt acctgcgcct tatcaacaac      1200
     cgtggcgacg acgccagctt cgagcgggtg gtcaataccc cgacccgcgg catcggcgat      1260
     cgcaccctcg agatactgcg aaacaacgcc cgcgatcagg gccagaacct gtggcagtcc      1320
     gccaaggccc tgctgggtga caaggtgctg accggccgcg ccggcaacgc ggtgcgcggt      1380
     tttgttgatc tcatcgacgc gctggaggag caggtctccc tgctgccgct gcaccagcag      1440
     gcggatatcg ccatccagca ctccggcctc aaggcgatgt atctggcgga aaaaggcgag      1500
     aaatcccagg cgcgggtgga gaacctggac gaactggtca ccgcctgccg ccagtaccag      1560
     cgcccggacg agctggaaga catgagcgat ctctccgcct tcctcgccca cgcggcgctg      1620
     gaatccggcg agaatcaggc ggacgaatat gccgacgcgg tgcagctgat gaccctgcac      1680
     agtgccaagg gcttggagtt cccgctggtg ctgctggtcg gcgtggaaga aggcatgttc      1740
     cccagccagc aatcgaccga ggagtcgggc cggctggaag aggagcgccg cctctgttac      1800
     gtcggcatga cccgcgccat ggagaagctc tacatctgtt atgcggagag ccgccgcatc      1860
     tacggccgcg agatgttcca caagccgagc cgctttatcc gcgagatgcc cgccgagtgt      1920
     ctggaagaga tccggctgcg cacccaggtg agccgtccca cccagtacgg ccgctttagc      1980
     cagaacgagg tgcagcagag cttcgacgcc agcggcatca agctcggcca gcgggtgctc      2040
     catccgaaat tcggggaagg catagtgctc aacttcgaag gggtcggcca gcagagccgg      2100
     gtgcagatcc agttcgacga cgtcggcgcc aagtggctgg tcaccgctta cgcgagattg      2160
     gagactcttt ag                                                          2172
//

If you have problems or comments...

PBIL Back to PBIL home page