(data stored in ACNUC7421 zone)

EMBL: CP000478.PE100

CP000478.PE100       Location/Qualifiers
FT   CDS_pept        complement(123131..124438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0101"
FT                   /product="trigger factor"
FT                   /note="TIGRFAM: trigger factor; PFAM: peptidylprolyl
FT                   isomerase, FKBP-type; trigger factor, C-terminal domain
FT                   protein; trigger factor, N-terminal domain; KEGG:
FT                   dps:DP2539 related to trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15804"
FT                   /db_xref="GOA:A0LEF2"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEF2"
FT                   /protein_id="ABK15804.1"
FT                   /translation="MNVSVVDLSENQKKLQVEIPPEKVRQEIEGKYREMSRRIKIKGFR
FT                   PGKVPRSIIKSYYGKTIEQEVSSQFIQETFPEALKETDLKPLVEADVSETHFNDSGSFS
FT                   YTAIVDVCPPFELEGYRGLEIRKPSIDVADEQVDSELQRLREQHAELRTLETERPAREG
FT                   DVAVIDFTPSVDGKVFEKGKSADYMAEIGKKAVHPDFDANLIGRRAGETVSFEVDYPEN
FT                   APMREIAGKRVLFEVTVKEVKEKVLPELDDDFAQAVNSRFDALDALKQTIREELLKREE
FT                   YQARSDVQQQILDQLLSKVKIELSAKVIDREVDRMVGNLLHQFESQGLKMDVSKFNTPE
FT                   IRADYRPQAERNILRRLILEKIADQENLKLTDEEIEQVYQEVARYARMDVATVKHEFAD
FT                   SAVVEQSKESKIQEKVFRFLESEAVSGHISQEEKSE"
     atgaacgttt ccgttgtcga tctcagtgaa aaccaaaaaa agcttcaggt ggaaataccc        60
     ccggaaaagg tgcggcagga aatcgagggg aaataccggg agatgtccag gcggatcaag       120
     atcaaagggt ttcggcccgg caaggtgccc cgcagcatca tcaagtccta ctacggcaaa       180
     accatagagc aagaggtctc ttcacaattc atccaggaga ccttccctga agcgctcaag       240
     gaaacggacc tcaaaccgct cgtcgaagcg gacgtcagcg agacgcactt caacgacagc       300
     ggttctttct cctatacggc gatcgtggat gtctgtccgc cgttcgagct ggaagggtac       360
     aggggcctgg aaatccgcaa accgagtata gacgtcgcgg atgagcaggt ggactcggaa       420
     ctgcagcgcc tgcgcgagca gcacgccgag ctccgcacgc tcgagacgga acgcccggca       480
     agggaaggcg acgtcgcggt catcgatttc accccttccg ttgacggcaa agtgttcgaa       540
     aaaggaaaat ccgccgatta catggcggaa atcggcaaga aggccgtcca tcccgacttc       600
     gacgccaatc tgatcggtcg ccgtgccggg gaaaccgtct ccttcgaggt cgactatccc       660
     gagaacgctc ccatgcggga gattgcggga aaaagggtgc tcttcgaggt gactgtcaag       720
     gaggtcaagg aaaaagttct gccggagctc gacgatgact tcgctcaggc cgtcaacagc       780
     cgcttcgacg ctctcgacgc cctgaagcag accattcgcg aggagctcct gaaaagggaa       840
     gaataccagg cgcggtcgga cgttcaacag caaattctgg accagctgct gagcaaggtc       900
     aagatcgagc tgtccgccaa ggtcatcgac cgcgaggtcg accggatggt gggaaatctg       960
     ctgcaccagt ttgagagcca gggactgaag atggacgttt ccaagttcaa cacgccggaa      1020
     atcagggccg actacaggcc gcaggccgag cggaacatcc tgaggcggtt gatcctggag      1080
     aagatcgccg accaggaaaa tctgaagctc acggacgagg agatcgagca ggtctaccag      1140
     gaagtggccc ggtacgcccg catggacgtg gccacggtga agcatgaatt tgcggacagt      1200
     gccgtcgtgg aacagtccaa ggaaagcaaa atccaggaga aagtgttccg gttcctcgag      1260
     tcggaagcgg tctccggtca catctcgcag gaagaaaaga gcgagtag                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page