(data stored in ACNUC7421 zone)

EMBL: CP000478.PE103

CP000478.PE103       Location/Qualifiers
FT   CDS_pept        126498..128426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0104"
FT                   /product="glucose inhibited division protein A"
FT                   /note="TIGRFAM: glucose inhibited division protein A; PFAM:
FT                   glucose-inhibited division protein A; KEGG: sat:SYN_01650
FT                   putative tRNA (5-carboxymethylaminomethyl-2-thiouridylate)
FT                   synthase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15807"
FT                   /db_xref="GOA:A0LEF5"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEF5"
FT                   /protein_id="ABK15807.1"
FT                   /translation="MNKYEVIVVGAGHAGCEAALAAARMGCRTLVLSICLDTVAHMPCS
FT                   PSVGGVGKGHLVREIDALGGRMALITDRTAIQFRLLNTKKGPAVWGTRTQNDKARYRIS
FT                   MKHCLESEPNLDLKQAHVESLAVEGNRIVGVIDQLGVFFGADAVVLATGTFLRGLVHIG
FT                   TTSVEAGRAGELASYPLANQLQRLGFTLGRMKTGTPARLGRRSIDFSRFREQHGDEAPK
FT                   PFSLFTDSIALPQVSCFIGKTHQRTHELVRRHIHLSPLYNGTIRGVSARYCPSLEDKVM
FT                   RFPDKDFHQIILEPEGLDTEEVYASGTGNSLPYDIQLRLIHSVPGLEEAEVMRPAYAIE
FT                   YDFVQPTQLKATLGSKLVEGLYMAGQINGTSGYEEAAGQGLWAGINAALKAQGRPPFIL
FT                   DRSEAYLAVMVDDLVTRGTNEPYRIFTSRAEYRLLLREDNADLRLLEKGCELGLHSADA
FT                   AKELRERRGAIRNELERLRLTHVRPSAQVNQTLAENHSPPLDAPAPLDKLLKRPELNYS
FT                   TVAILSPPPEPLSSKVTEQVEVECKYEGYLKRQEAEVAKFRQLEQAAIPEDLMYDDIPG
FT                   LSNELRQKLGAVRPLSLGQATRIPGMTPAAVSVLMVHLRRRAQGGPFLAPVLDPGVNMH
FT                   SQKKKLA"
     atgaacaaat acgaggtgat tgtcgtgggg gcgggccatg cggggtgtga agcggccctg        60
     gcggccgcgc gcatgggctg ccgcacgctg gtgttgtcca tatgcctcga caccgttgcc       120
     cacatgccgt gctcgccttc ggtgggcggg gtcggcaagg gacacctggt gagggagatc       180
     gatgctctcg gcggccgaat ggctctgatc acggaccgga ccgccatcca gttccgtctg       240
     ctcaacacca agaagggacc cgcagtatgg gggacacgca cgcaaaacga caaggcgcgc       300
     taccgcatca gcatgaaaca ttgcctggaa tcggaaccca acctggacct caagcaggcg       360
     cacgtggaat ccctggcggt ggaaggcaac cggatcgtgg gagtgatcga tcaactgggt       420
     gtcttttttg gtgccgatgc ggtcgtcctg gccacgggca ctttcctgcg cggcctggtc       480
     cacatcggaa cgaccagcgt ggaggcgggc agggcggggg agcttgcttc gtatccgctc       540
     gcgaaccagt tgcagcgact cgggttcacc ctggggcgaa tgaaaaccgg gacccccgca       600
     cgactggggc ggcgaagcat cgacttcagc cgattcagag agcaacacgg ggatgaggcg       660
     ccgaagccgt tttctctttt caccgattcg atcgctctgc cacaggtctc atgtttcatc       720
     ggcaagactc accaacgcac ccatgagctg gtgcgacgcc atattcacct gtccccgctc       780
     tacaacggca ccatccgggg ggtgtccgcg cgctactgtc cgtccctgga agacaaggtg       840
     atgcgattcc cagacaagga cttccaccag atcatcctgg agcccgaggg actcgatacc       900
     gaggaggtct acgccagcgg caccggcaat tcccttcctt atgatatcca gctccggctt       960
     atccactcgg tgcccggcct ggaagaagcg gaagtgatgc gcccggcata cgccatcgag      1020
     tacgatttcg ttcagccgac tcaactcaag gccaccctgg ggagcaagct ggtcgagggt      1080
     ttgtacatgg ccgggcagat caacgggact tcgggttacg aggaggcggc cgggcagggg      1140
     ctgtgggccg ggatcaatgc cgcgctcaag gctcagggaa gaccgccctt catcctggat      1200
     cgttcggaag cctacctggc cgtcatggtg gacgatctgg tgaccagggg aaccaacgag      1260
     ccgtacagga ttttcacctc gcgcgcggaa taccggctcc tgttgcggga agacaatgcg      1320
     gacctcaggc tgctcgagaa ggggtgcgaa ctggggttgc actcggccga tgcggccaag      1380
     gagttgagag agcggcgcgg agcgatccgg aatgaactgg agaggcttcg cctgacccac      1440
     gtgcgcccct cggcgcaagt caatcaaacc ctggcggaaa accattcgcc tcccctggat      1500
     gctcctgctc ctctggacaa gctcctcaaa cgtcccgagc tgaattactc gaccgtggcc      1560
     atcctgtcac cgcctcccga gccgttgtcg agcaaggtga cggaacaggt cgaagtggaa      1620
     tgcaaatatg agggatatct gaaacgccag gaggcggaag tcgcgaagtt caggcaactc      1680
     gagcaggcgg ctattccgga agatttaatg tatgacgaca tccccggcct ttccaatgag      1740
     ctccggcaga agctcggggc ggtacggccg ctctctctcg gccaggcgac gaggattccg      1800
     ggtatgacgc ccgcggccgt ttccgtgctg atggttcatc tgcgacgccg cgcccagggc      1860
     gggcctttct tagcgccagt gctcgatccg ggtgtaaata tgcattctca aaagaaaaag      1920
     cttgcttaa                                                              1929
//

If you have problems or comments...

PBIL Back to PBIL home page