(data stored in ACNUC7421 zone)

EMBL: CP000478.PE105

CP000478.PE105       Location/Qualifiers
FT   CDS_pept        129310..130110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0106"
FT                   /product="electron transfer flavoprotein beta-subunit"
FT                   /note="PFAM: electron transfer flavoprotein beta-subunit;
FT                   KEGG: sat:SYN_02636 electron transfer flavoprotein
FT                   beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15809"
FT                   /db_xref="GOA:A0LEF7"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEF7"
FT                   /protein_id="ABK15809.1"
FT                   /translation="MAVNIVVILKQTPDTESVIRLAENKKSIVTRDLKWIINPYDEFAI
FT                   EAALRLKEKHGGKVTVVSYGPSRVVEALRTALAMGADDAVHLDDIALKSVDFLRVTRAL
FT                   TAAVKELNPDIILIGSRAVDYDQGQRGAIVAEHLGWPHLALAVSLESDGKTVTIERPIE
FT                   GGKVTLEAALPALVTVGGSHTIWNPRYASLPGIMKAKKKPLVVKKIADLGLDPALFKPE
FT                   TARIWITSLEMPPQRAPGRIIDGADAEDKARKLVTALHEEAKVI"
     atggctgtga atattgttgt catactcaaa cagactcctg atacggaatc ggtgattcgt        60
     cttgccgaga acaagaagtc gattgtcacg cgggacctga agtggatcat caacccctac       120
     gatgaatttg caatagaagc tgcgctcagg ctgaaggaaa agcacggcgg caaagtgacc       180
     gtggtgagtt acggcccctc ccgggtcgtg gaggcgctcc gaaccgctct ggccatgggg       240
     gccgacgatg ccgtccacct ggacgacatc gcattgaaga gcgtcgactt ccttcgagtg       300
     acccgggcac tgacggccgc cgtcaaggaa ttgaacccgg acatcatcct gatcggttcg       360
     cgggccgtcg actacgatca gggacaacgc ggcgcgattg tggcggagca tctgggctgg       420
     cctcatctcg cgctggccgt atccctcgag tccgacggca aaacggtgac tatcgagcgt       480
     cccatcgagg gcgggaaggt caccctcgag gccgccctgc ctgccctggt gaccgtcggc       540
     ggttctcaca ccatctggaa tccgcggtac gcttcgttgc cgggaatcat gaaagccaaa       600
     aagaagcccc tggtggtgaa gaagattgcg gatctgggac tggaccccgc gcttttcaag       660
     ccggaaacgg ccaggatatg gatcacctct ctcgagatgc ctccgcaacg cgctccggga       720
     cgcattatcg acggcgccga cgcggaggac aaggcgagaa agcttgtcac ggctttgcac       780
     gaagaagcca aggtgatcta g                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page