(data stored in ACNUC7421 zone)

EMBL: CP000478.PE106

CP000478.PE106       Location/Qualifiers
FT   CDS_pept        130130..131119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0107"
FT                   /product="electron transfer flavoprotein, alpha subunit"
FT                   /note="PFAM: electron transfer flavoprotein beta-subunit;
FT                   electron transfer flavoprotein, alpha subunit; KEGG:
FT                   sat:SYN_02637 electron transfer flavoprotein alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15810"
FT                   /db_xref="GOA:A0LEF8"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEF8"
FT                   /protein_id="ABK15810.1"
FT                   /translation="MGKCVCMIAEFRGGNFRRVSFEVASEGKRIADALGIGLRGVAVGS
FT                   GVAGKAAELGQYGVERVLVRDDPALEHYLAEIYVPVVAEMIKKCDPAVVILPASVDGRD
FT                   LGARLGARLDITLVQDVTQVVCEGGKVKARWPIFGGKCFAWSEWADGTLPIMSCRPNVM
FT                   DCLPPDTSKRAEVELADIPIPESRSRVKAVDMDSSGKVELSEADIIVSGGRGMKEASNF
FT                   ALVEELAKAMGAAVGASRAAVDAGWRPHSDQVGQTGKVVTPALYVAVGISGAIQHLAGM
FT                   GYSRYIVAINKDPEAPIFSRADYGIVEDLFKFVPAFTEEVKRLKSTCS"
     atggggaaat gcgtgtgcat gattgctgaa ttccgtggcg gaaattttcg ccgcgtgtcg        60
     tttgaggtcg ccagcgaagg aaagaggatc gcggatgctt tggggatcgg cctgcgtggc       120
     gtcgccgtcg gttcgggcgt cgcgggcaag gctgcggaac tgggacaata cggggtggag       180
     agggtgctgg tgagggacga tcccgcgctg gagcactacc ttgcggaaat ctacgtgccg       240
     gttgtggcgg agatgatcaa gaaatgcgac cctgcagtgg tcatcctccc cgcatccgtg       300
     gacgggcggg accttggggc gagactggga gcccggctcg acatcactct ggttcaagac       360
     gttacccagg tcgtgtgcga aggggggaaa gtcaaggccc ggtggcccat ctttggagga       420
     aaatgctttg cgtggagcga atgggccgat ggaacgctgc cgatcatgtc ttgccggccc       480
     aacgtgatgg attgtctgcc gcccgacacg tcaaagcggg cggaggtgga actggcggat       540
     attccgatcc cggagagccg ctcgcgggtc aaggccgtcg acatggactc ttccggcaag       600
     gtggagctgt cggaggccga cattatcgtg tccggcggca gaggcatgaa ggaagcttcg       660
     aatttcgccc tcgttgaaga attggccaaa gccatggggg ccgccgtggg cgcttcccgc       720
     gcagcagtgg acgccggttg gcgtccccat tccgaccagg tcggccagac cggaaaagtc       780
     gtcacccccg ctctttacgt ggcggtgggg atttccggcg ccatccagca cctggccggc       840
     atgggctact ccaggtacat cgtggccatc aacaaggatc ccgaagcgcc gattttcagc       900
     agggccgatt acggcattgt agaagacctc ttcaaattcg ttcccgcttt tacggaggaa       960
     gtcaagagac tgaaaagcac ctgctcgtga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page