(data stored in ACNUC7421 zone)

EMBL: CP000478.PE108

CP000478.PE108       Location/Qualifiers
FT   CDS_pept        132962..133678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cac:CAC1606 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15812"
FT                   /db_xref="InterPro:IPR007368"
FT                   /db_xref="InterPro:IPR041652"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEG0"
FT                   /protein_id="ABK15812.1"
FT                   /translation="MTDRFPGLHDERQWVLNQAAADFYLLQNRLYPRRAALEWVGNRYR
FT                   LTVRERELLNRGVFGQAEALARKAKRRCASALGGQCLVVDGHNVQITVESAVLGRPLLK
FT                   ANDGAVRDVAGQSARYRLSETSEVALDMIFQFLGIFRPGRVDFLFDAPMSHSGMLASAC
FT                   RRRLKSLGLDGDARAVPVPEREMTRAECIVAGSDRAVLDACSRWHDLAHEVIDLSCPCN
FT                   MFVDFSDLILAQSRRS"
     atgacggacc ggttcccggg cttgcatgat gagcggcaat gggtgctcaa tcaggccgcc        60
     gccgacttct acctcctgca gaatcggctg tacccgcgca gggccgcgct tgagtgggtg       120
     ggtaaccgat atcggctgac cgttcgggag cgggaactgc tcaatcgcgg tgtattcggg       180
     caggcggagg cccttgcccg caaggccaag aggagatgtg cgtccgccct gggcgggcaa       240
     tgtctggtgg tggacggcca caacgtgcag ataacggtgg agagcgccgt tctggggcgc       300
     cccctgctca aggccaacga tggagcggtg cgtgacgtgg cgggacagtc ggctcgatat       360
     cggctgtcgg aaacgagcga ggtggctctg gacatgattt ttcaattcct gggcatcttt       420
     cggcccgggc gggtcgattt tctgtttgat gctccgatga gccacagcgg catgctggca       480
     agtgcctgtc gacggcggtt gaagtccctc gggctggacg gcgacgcgcg cgcggtgccc       540
     gtaccggagc gtgaaatgac ccgggcggaa tgcatcgtgg ccggcagcga ccgggcggtc       600
     ctggacgcct gcagccgatg gcacgacctg gcccacgaag tgatcgacct ttcatgtccc       660
     tgcaacatgt tcgtggattt ttcagacttg atcctggctc aatcccggcg gtcctga          717
//

If you have problems or comments...

PBIL Back to PBIL home page