(data stored in ACNUC7421 zone)

EMBL: CP000478.PE115

CP000478.PE115       Location/Qualifiers
FT   CDS_pept        complement(140763..141047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0116"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: sat:SYN_01726 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15819"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEG7"
FT                   /protein_id="ABK15819.1"
FT                   /translation="MICETVKTGAECAFMTKSGCGYNGGFCHPVVEQCEGCQRTSEWSN
FT                   GIYCTSYPNPAVKWRSSTCNFATHAKAEQQGLQQKINPLKASKRSNKKK"
     atgatttgtg agactgtaaa gaccggagcg gagtgtgcct tcatgaccaa atcgggatgc        60
     ggctacaatg gaggcttctg ccacccggtc gtcgaacagt gcgagggctg ccagcgtacg       120
     tcggaatggt ccaatgggat ctattgcacc agttacccca accccgccgt caagtggagg       180
     tcgagcacct gcaacttcgc aacccatgcg aaggccgagc agcagggtct gcagcaaaag       240
     atcaaccctc tcaaagcttc caagcgcagc aacaagaaga aataa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page