(data stored in ACNUC7421 zone)

EMBL: CP000478.PE116

CP000478.PE116       Location/Qualifiers
FT   CDS_pept        141441..143156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0117"
FT                   /product="type IV-A pilus assembly ATPase PilB"
FT                   /note="TIGRFAM: type IV-A pilus assembly ATPase PilB; PFAM:
FT                   type II secretion system protein E; General secretory
FT                   system II, protein E domain protein; KEGG: gme:Gmet_1393
FT                   type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15820"
FT                   /db_xref="GOA:A0LEG8"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR013374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEG8"
FT                   /protein_id="ABK15820.1"
FT                   /translation="MAGKVRFVAKKIGELLLQEGLISKEQLDRALNEQHQTGERIGGVL
FT                   LKLGFVSEEMLTEFIAKQYSAPQVNIAKLTVPKDVLGLIPLDIAAKYQAVPFGVMGTTV
FT                   NVAMADPGNLFVIDDMRFLTRKNIQVHVASEPAIKKLLSQFYAPDDNFDDVLGMLKEDV
FT                   DVDVIETAEEMDLSFLEDAAEQAPVVKLVNLIMMDAIRKQASDIHLEPYEKLMRVRFRI
FT                   DGVLYEIMRPPLQLKNALISRIKIMARLDIAERRLPQDGRIKLKAKGREMDFRVSVLPT
FT                   LFGEKVVLRLLDKSGLQLDMTKLGFEELQYKHFREAIYQPFGMVLVTGPTGSGKTTTLY
FT                   SALSELNKLSHNISTAEDPVEYNMVGINQVQIHDAIGLNFANALRSFLRQDPDIIMVGE
FT                   VRDFETAEIAVKAALTGHLVLSTLHTNDAPSTINRLLNMGVESFLVSSAVNLVIAQRLV
FT                   RRVCLECREVEDVTHETLLDLGLREDELGTFECFRGRGCAVCNDTGYRGRVALYEVMPM
FT                   HEQIRELVLMGASAAEIKKESIRLGMITLRRSGINKLKAGITSVEEVIRSSAKD"
     ttggctggaa aggtgagatt tgtggccaag aaaatcgggg aactgcttct tcaggaagga        60
     ttgatcagca aggaacagct tgaccgggct ctgaacgagc aacaccaaac cggggaacga       120
     atcggagggg tcctactcaa actgggattc gtcagtgaag aaatgctcac ggagttcatt       180
     gccaagcagt acagcgctcc tcaggtgaac atcgctaaac tgaccgtccc taaagatgta       240
     ctcggtttga ttcccctcga tatcgccgcc aagtaccagg ccgttccctt cggtgtgatg       300
     ggaactaccg tgaacgttgc catggcggat ccgggcaatc tgttcgtgat cgatgacatg       360
     cgcttcctga cgaggaagaa catccaggtt cacgtggctt ccgaaccggc gatcaagaaa       420
     ctgctcagcc agttctacgc gccggatgac aatttcgacg acgtccttgg catgctcaag       480
     gaagacgtcg atgtcgacgt catagaaacc gcggaggaga tggatctctc tttcctggaa       540
     gacgccgcgg aacaggcgcc cgtggtcaaa ctggtgaatc tcatcatgat ggatgcaatc       600
     cggaaacagg cgtcggacat ccatctcgag ccatatgaaa agctgatgcg ggtacggttt       660
     cgaatcgacg gcgtgctcta cgaaatcatg cgaccgccgc tgcaactgaa aaacgcgctg       720
     atctcgcgca tcaagatcat ggctcgtttg gacatcgcag agcggcggct gccccaggac       780
     ggccgcatca agctcaaggc caaggggcgc gagatggatt ttcgcgtttc cgtcctgccg       840
     acgctgttcg gcgaaaaggt ggttctgcgt ctgctggata agtccggtct gcaactggac       900
     atgaccaagc tggggtttga ggagctccag tacaaacatt ttcgagaggc catctaccag       960
     ccttttggaa tggtgctggt gaccggcccc acagggagcg ggaagaccac gacgctctac      1020
     agcgccctct cggagctcaa caagctgagc cacaacatct ccaccgcgga ggaccccgtc      1080
     gaatacaaca tggtcggcat caaccaggtg cagatccacg atgccatcgg gctcaacttc      1140
     gcgaacgcgc tgcgatcatt cctgcgtcag gaccccgaca tcatcatggt cggtgaggtg      1200
     cgggatttcg aaacggcgga aatcgccgtg aaagcggcgc tcacgggaca cctggttttg      1260
     agcaccctgc acaccaatga cgctccgagc accatcaacc ggctgctcaa catgggcgtg      1320
     gaatccttcc tggtttcatc cgccgtcaac ctggtcatcg cgcagagact ggtgcggcgg      1380
     gtgtgtctgg aatgtcggga agtggaggat gtgactcatg aaacccttct cgacctgggg      1440
     ttgagagagg atgagctggg gactttcgaa tgtttccggg ggcgggggtg cgcggtgtgc      1500
     aatgacacgg gatatcgagg gcgagtggca ttgtacgaag tgatgcccat gcatgaacag      1560
     atccgcgaac tggtgctcat gggggcttcc gccgcggaga tcaagaaaga gtccattcgc      1620
     ctggggatga tcactctgag gcggagcggc atcaacaagc ttaaggctgg gattacctcc      1680
     gtggaggaag tcataaggtc ttccgccaag gactaa                                1716
//

If you have problems or comments...

PBIL Back to PBIL home page