(data stored in ACNUC7421 zone)

EMBL: CP000478.PE117

CP000478.PE117       Location/Qualifiers
FT   CDS_pept        143223..144440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0118"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   sat:SYN_01284 general secretion pathway protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15821"
FT                   /db_xref="GOA:A0LEG9"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEG9"
FT                   /protein_id="ABK15821.1"
FT                   /translation="MPIYLWSGTDRAGKKQKGEIEADNLALARQMISRKNITIKNMRLK
FT                   PKDISEYIPALQGGVKEKELVIFVRQFSTMIDAGLPLVQCLEILQEQQENSTFKRIIKK
FT                   VKKDVEEGATLSDAIRKHPKVFDNLFVNLVAAGEVGGILDVILNRLAAYIEKVAKLKRR
FT                   VKGAMTYPAIVVTIALLVVAVILIYVIPVFAGLFREAGAKLPAMTLAVMNLSDFAQNYF
FT                   HWIILGLVLAYLGFRQFRKNDKGRELTDRLALRIPVFGGLLRKVAVARFTRTLGTMLAS
FT                   GVPILDGLDIVAATSGNMVIEKAIRVARNAISEGRPIAEPLSETKVFPMMVTQMIAVGE
FT                   ATGALDTMLGKIADFYDDEVDTAVDALTSLLEPMLIVFLGVTIGGLLVAMYLPIFQIAD
FT                   VVGRGA"
     atgcccattt atctctggtc ggggaccgat cgtgcgggga agaagcagaa aggggaaatc        60
     gaggcggaca acctggctct tgcccgccag atgatctcgc gcaagaacat caccatcaag       120
     aatatgcggc tgaaacccaa ggacatcagc gagtatattc cggcgctgca gggcggggtc       180
     aaggaaaagg aactggtcat cttcgtgcgc cagttttcaa ccatgatcga tgcgggcctg       240
     cccctcgtgc aatgcctgga aatcctccag gagcagcagg agaactccac cttcaagagg       300
     atcatcaaga aggtgaagaa ggatgtggaa gaaggggcga cgctctccga tgcaattcgc       360
     aagcacccga aagtgtttga caatcttttt gtgaacctgg tcgccgccgg ggaagtgggc       420
     ggcatcctgg acgtcattct gaaccgcctg gccgcctata tcgaaaaggt ggccaagctc       480
     aagaggagag tcaagggcgc catgacctat ccggcgatcg tggtcaccat cgccctgctc       540
     gtcgtggcgg tcatcctcat atacgtcatt cccgtgtttg cggggctctt cagagaggcg       600
     ggggcaaagc tcccggcaat gacccttgcg gtcatgaatt tgagcgactt cgcgcagaac       660
     tacttccact ggatcatact gggactcgtt ttggcctatc tcggtttcag acaattcagg       720
     aaaaacgata aggggcggga actcaccgat cggctggcct tgaggatccc ggtgttcggg       780
     gggctcttga ggaaagtcgc cgtcgcccgt ttcacccgga ccctgggaac catgctggcc       840
     agtggagtgc ctattctcga cggcctcgac atcgtcgcgg ccacttccgg caatatggtc       900
     atcgaaaagg cgatccgcgt ggcccggaac gcgatttccg aagggcggcc catcgcggag       960
     ccgctcagtg aaaccaaggt ctttccgatg atggtgaccc agatgatcgc ggtgggcgaa      1020
     gcaacgggcg ccctggacac gatgctcggg aagatcgccg acttttacga cgatgaagtc      1080
     gataccgccg tcgatgcgct gacgtctttg ctcgaaccca tgttgatcgt ctttctcggc      1140
     gtgaccatcg gcggattgct ggtcgccatg tatctcccca tcttccagat cgcggacgtg      1200
     gtgggcagag gagcgtaa                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page