(data stored in ACNUC7421 zone)

EMBL: CP000478.PE118

CP000478.PE118       Location/Qualifiers
FT   CDS_pept        144442..146157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0119"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase A domain protein domain protein; PAS fold domain
FT                   protein; KEGG: gme:Gmet_1396 signal transduction histidine
FT                   kinase, nitrogen specific, NtrB"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15822"
FT                   /db_xref="GOA:A0LEH0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEH0"
FT                   /protein_id="ABK15822.1"
FT                   /translation="MQVDYDLEVNTINGELALRRKIQGLLLFRLLLAVFFLLLTIIVQS
FT                   RRDQDLLSAHLQPIYFFSCILFVFTIVGALSLGRIRNLKRFAYVQLFFDVGAVTVLIYL
FT                   SGGVESLFSFLYMPVIICAAVLLYRRGSLLTAAFSSVCYGTLLDLQYFGWLLPLHVVNQ
FT                   TAQARDSGSYFHSILMNIAVFYLVAFMSGYLAEELQKSSLKIVEQSKDLRRLEVLHRNI
FT                   VHSITSGLITIGPSGEILFCNNFAQDILGLRSEPVTGRRFSSIFPGLDPLTWPRVVGPG
FT                   PGHKKGPPERPEIVYRNPLGEELHLGYAVSVLQNETGKWAGWIFIFQDLTQFKAMEEHL
FT                   KRLERLVFAGRIAAEISHEIKNPLAAMSGAVQMLEDESIPDGSRARLMSIIHREIDRMN
FT                   SLVKDFLWLAKSTHGPENVENVPVCDLIQEILDLLSARNRVASEHVIKTAFAASPISRI
FT                   DPHHFRQIVWNLLVNALDAMPGGGHLTIAVGLHPSGDGSGRETRIDISDSGSGIPRDAR
FT                   TRIFEPFFTTKSQGTGLGLSIVYHLVEKANGRIEVTHHEEPCGTTFSLFFPLAS"
     gtgcaggtcg actacgacct ggaggtaaat acaatcaacg gtgagttggc gttgcgcagg        60
     aagatacagg ggctgctcct ctttcggttg ctgcttgctg tattcttcct gctgctcacc       120
     atcatcgtgc agagccggcg cgatcaggac ctcctctccg cccatcttca gcccatctac       180
     ttcttttcct gcatcctttt cgttttcacc atcgtggggg cgctcagcct aggacgtatc       240
     cggaacctga agcgatttgc ctacgtccag ttgtttttcg acgtgggagc ggtgaccgtg       300
     ctgatttacc tgtcgggcgg cgtggaaagc ctgttctcat ttctctacat gcccgtcatc       360
     atttgcgccg ccgtgctcct ctaccgccgc gggagtctgc tcaccgcggc cttcagcagc       420
     gtctgttacg gaaccttgct ggatcttcag tatttcgggt ggctgcttcc cctacacgtg       480
     gtcaaccaaa ccgctcaagc gcgggacagc ggctcctatt tccacagcat cctcatgaac       540
     atcgccgttt tttacctggt tgcgttcatg agcggttatc tggcggagga actgcaaaaa       600
     tccagtctga agatcgtcga acagagcaag gaccttcggc gcctggaggt tctgcatcgg       660
     aacatcgtcc acagcatcac cagcggtctc ataaccatcg ggccgagcgg agaaatcctc       720
     ttctgcaaca acttcgcaca ggacatcctc gggttgcgct ccgagccggt cacgggtcgc       780
     cggttttcgt ccattttccc cggcctcgat cccttgacgt ggcctcgagt ggtcggcccg       840
     ggaccaggac ataaaaaagg gcctccggaa cgccctgaaa tcgtttatcg aaaccctctc       900
     ggcgaggagc ttcacctggg gtatgccgtc tccgttctcc agaatgagac cggcaaatgg       960
     gccggatgga tcttcatctt tcaggacctg acccagttca aggccatgga ggagcacctc      1020
     aagcgcctgg aacggcttgt gtttgcgggg cggattgcgg cggagatttc acacgagatc      1080
     aagaaccccc tcgcggcgat gagcggcgcg gtgcagatgc tcgaggatga gtcgatcccc      1140
     gacggcagcc gggcgcggtt gatgagtatc attcatcgcg agatcgatcg aatgaacagc      1200
     ctcgtgaagg actttctgtg gcttgcaaag agcactcacg gtccggagaa tgtcgaaaac      1260
     gtgccggtgt gcgatctcat ccaggaaatc ctcgatcttc tgagcgcgcg gaaccgggtc      1320
     gcgtccgaac acgtcatcaa gaccgcattc gcggcctctc ccatttcgcg catcgacccc      1380
     caccatttca ggcagatcgt gtggaatctg ctcgtgaacg cgctggacgc catgcccgga      1440
     ggcggccatc tgacgattgc cgttggattg cacccctcag gcgacggctc cggccgggaa      1500
     acccggatcg atatcagcga ttccgggtcc gggattccgc gggacgcgcg gacgcgcatc      1560
     ttcgaaccgt tcttcaccac gaagagccag ggaaccggcc tggggctcag catcgtctat      1620
     caccttgttg aaaaggcgaa cggccgcatc gaagtcaccc atcacgaaga accgtgcggt      1680
     accaccttct cgcttttttt cccccttgca tcctga                                1716
//

If you have problems or comments...

PBIL Back to PBIL home page