(data stored in ACNUC7421 zone)

EMBL: CP000478.PE125

CP000478.PE125       Location/Qualifiers
FT   CDS_pept        complement(155744..156199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0126"
FT                   /product="Tfp pilus assembly protein PilE-like"
FT                   /note="KEGG: type IV pilus biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15829"
FT                   /db_xref="GOA:A0LEH7"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEH7"
FT                   /protein_id="ABK15829.1"
FT                   /translation="MFIKMRESKGFTLVELMIVVAIIGILAAVAVPYYQKYIQKSRMVS
FT                   KVFPGMHAIETNMGTYFSFKNTLLDVGSTATFGQFVQDADTKCFSPSWAGEYLLITIKD
FT                   PTLCQELKALTGMTLSATPRMDTSRTKIRGWALAGPLAVQLGLEGEQ"
     atgtttatca agatgcgtga aagtaagggt ttcaccctgg ttgagttgat gatcgtcgtg        60
     gctattatcg gtattctggc cgccgtggcg gtgccgtact atcagaaata catccagaag       120
     tcccgcatgg tttcgaaggt tttccccggc atgcatgcca tcgagaccaa catgggcacg       180
     tacttcagct ttaagaacac gttgcttgac gtcggtagca ctgccacctt cgggcagttt       240
     gtgcaagacg ccgacactaa gtgcttctcc cccagttggg cgggcgaata tctgctgatc       300
     acgattaagg atcccacctt gtgccaggaa ctgaaggcac tgacggggat gaccctctcc       360
     gcgacgccga ggatggatac cagccggacc aagatcaggg gctgggctct cgctggtccc       420
     ctggccgttc agctcggact cgagggcgag caatag                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page