(data stored in ACNUC7421 zone)

EMBL: CP000478.PE132

CP000478.PE132       Location/Qualifiers
FT   CDS_pept        complement(165622..166815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0133"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   pol:Bpro_5331 transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15836"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEI4"
FT                   /protein_id="ABK15836.1"
FT                   /translation="MSRALSDRRDQAKVHHGQEELLRQRLFAIAMGYEDGNDHQSLRFD
FT                   PGLKTAVGRLPETDPALASQPTLSRFENRVGNCELRRLSDALIDAYVAAHPAPRKVIVL
FT                   DMDATDDPVHGLQQLSFFHGYYDQYMLHPLLIFDGLTGFPVAAVLRAGNAHASKGAAAI
FT                   LKRIIRRLKHAYPGATILVRADAGFAVPAIYRLLEREKVKYTIGLITNDRLRKRAANLV
FT                   IKAERQFAKTGAKQRLFGSFYHRAGSWQRSRRVIAKVERLSRGLNTRFVVTNILESAAG
FT                   IYDGIYTGRGDAENRIKELKVHLKADRLSCTRFQANQFRLLLHTFAFVLFWHLRRSLAG
FT                   TELAAATVDTLKLKLLKVGARVVQSVRRILFTMPRAYPYQRLFATALQNIRQMPLRC"
     atgagccggg cactttccga ccgtcgcgat caggccaaag tgcaccatgg ccaggaggaa        60
     ctcttgcgcc aacgcctttt cgccattgcg atgggctacg aagacggcaa cgatcatcaa       120
     tccctgcgct ttgatccggg gctcaaaacc gccgttggca ggttgcccga aaccgatccg       180
     gcactggctt cccaaccgac gctctcacgt ttcgaaaacc gtgtagggaa ctgtgagctt       240
     cgccgcctga gcgacgccct gattgacgcc tatgtggccg cacacccggc tccgcgcaag       300
     gtaatcgtgc tcgatatgga cgcaacggat gatcccgttc acggcttgca gcaactctcc       360
     ttcttccacg gctactacga tcagtacatg ctgcatccgc tgctgatctt tgacgggctc       420
     accggttttc cggtagccgc ggtgctgcgc gcgggcaacg cacacgcgtc caaaggagcg       480
     gcggcaatct tgaagcgcat catccgccgc ctcaaacatg cctatccggg cgccactatt       540
     ctggtgcgcg ccgatgcagg ctttgccgta ccggccatct acaggctcct tgagcgcgag       600
     aaggtcaaat acacgatcgg cctgatcacc aatgaccgtc ttcgcaaacg tgccgccaac       660
     ctggtgatca aagccgagag gcagttcgcc aaaaccggag cgaagcaaag actctttggc       720
     agcttttacc atcgagccgg atcctggcaa cgatcacgtc gggttattgc caaggtcgag       780
     cgactctccc ggggcctcaa cacccgcttt gtggtgacca acatccttga atccgccgca       840
     gggatttatg acggcatcta caccggccgg ggcgatgccg agaaccggat caaggagctc       900
     aaggttcatc tcaaagccga tcggctgagc tgcacccggt tccaggccaa ccagtttcgg       960
     ctgctgctgc acaccttcgc cttcgttctg ttttggcacc tgcgccggag ccttgccgga      1020
     acggaactgg ctgccgccac agtcgacacc ctcaagctca aactgctcaa agtcggcgca      1080
     cgggtggtcc agagcgtgcg gcgcatcctc tttaccatgc cgcgcgccta tccctatcaa      1140
     cgcctctttg ccaccgcact gcaaaatatt cggcaaatgc cgctccgatg ctga            1194
//

If you have problems or comments...

PBIL Back to PBIL home page