(data stored in ACNUC7421 zone)

EMBL: CP000478.PE135

CP000478.PE135       Location/Qualifiers
FT   CDS_pept        168224..169528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0136"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG: mac:MA1882
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15839"
FT                   /db_xref="GOA:A0LEI7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEI7"
FT                   /protein_id="ABK15839.1"
FT                   /translation="MRRKTLRFLSRKALGGRHMVKRELWYEVQSRFKLKESKKSIARSL
FT                   ELSVQTVRSVLKQKAAPSYRRGPGKRTLLSPFEDHIHRRLAALGYCSRAIYEELVEQGY
FT                   TGCYDTVRRFVQPLRKEAQTKATMRFETPPGRQAQVDWGQCWTLISGKRIKVHLFVMTL
FT                   GYSRRLFAKATWDERLATFLACHEEAFEHFGGAAHELVYDNAKTVVVSRDVEGRNVKWN
FT                   ATFWDFSTYYGFRAWAHRPYRAQTKGKVESGVRYVKRFVRGKAFESMAHLNTLLGRWLA
FT                   TVADLRIHGTTHQRPIDLFEQERTLLLPTGAKPPYQVRERAVRYVARDCMVSFETNRYS
FT                   VPLRFVGKPVEVQCANDRILIFHEGSLIVSHPCCTGKHQSLVDREHYTGIFYGIELPSV
FT                   RMLAFDHALPLCSREEVEVRDLAFYERLAQEGGAS"
     atgcgaagaa aaacgttacg tttcctctca aggaaagcct tgggaggaag acacatggtc        60
     aagcgcgaac tttggtatga ggtccagagc cggttcaagt tgaaggaatc gaagaaatcg       120
     attgcccgat ccctggaatt gagtgtgcaa acggtccgaa gcgttctcaa gcagaaggcg       180
     gctccgagct accgccgggg gccggggaag cgcacgctgt tgtccccttt cgaggaccac       240
     atccacaggc gactggcggc actcggctac tgctcccggg cgatttacga agagctggtg       300
     gaacaggggt acaccggttg ttacgacacg gtaagacgct ttgttcagcc tttgcgcaag       360
     gaagcgcaga caaaagccac gatgcgtttt gaaaccccgc ccggacggca ggcgcaggtg       420
     gactgggggc aatgttggac cctcatttcg ggtaagagaa tcaaggtcca tctgttcgtc       480
     atgacccttg gctacagccg gcgtcttttt gcgaaggcga cctgggatga gaggcttgca       540
     acgtttttgg cttgtcacga ggaagcgttc gagcactttg ggggcgccgc ccatgagctc       600
     gtctacgata acgccaaaac ggtcgtggtc tcgcgcgacg tcgagggacg aaacgtgaag       660
     tggaatgcga ccttctggga cttcagcacc tactacggtt tccgggcctg ggcccatcgc       720
     ccctaccggg ctcaaaccaa gggcaaggtg gaatcgggcg tgcgctatgt caagcgtttc       780
     gtgagaggca aggccttcga atccatggct catctgaaca cgctccttgg ccggtggctg       840
     gcaacggttg ccgatctgag gattcacggc acaacccatc agcgtcccat cgatcttttc       900
     gagcaggaac ggactttgct cctgcccacc ggggccaagc ccccttacca ggtccgggaa       960
     cgtgccgtgc gctatgtggc ccgggactgc atggtaagct ttgaaaccaa ccgctattcg      1020
     gtgccgctgc ggtttgtggg aaaaccggtc gaggttcagt gcgcaaacga tcgcattctg      1080
     attttccacg aggggagtct catcgtgagc catccttgtt gcacgggcaa acaccagtcc      1140
     ctggtggacc gggagcacta caccgggatc ttctacggca tcgagcttcc ctcggtgcgc      1200
     atgctcgcct tcgaccacgc tcttcccctt tgcagccggg aggaggtgga agttcgagac      1260
     cttgccttct acgagcgcct cgcgcaggaa ggaggtgcct catga                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page