(data stored in ACNUC7421 zone)

EMBL: CP000478.PE136

CP000478.PE136       Location/Qualifiers
FT   CDS_pept        169525..170304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0137"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: chy:CHY_1116 ISChy4, transposition
FT                   helper protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15840"
FT                   /db_xref="GOA:A0LEI8"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEI8"
FT                   /protein_id="ABK15840.1"
FT                   /translation="MSSTQLVRIQERLKHLKLYRINEQLESRLEEASRGNVSYGDFLDQ
FT                   LLDEEVSAKKEKNISMRTSMARFPFVKTLESFDFAFQPSIDKKRINELAACRFIANGEN
FT                   VILLGPPGVGKTHLAVALGIKAVTEGYRTHFTQAMPLVASLTKAYAENRIEERLKFYCQ
FT                   PKLLIIDEIGYIPIDRHGAHLFFQLISRRYERGALIVTSNRSFGQWNEIFGDTVIATAI
FT                   LDRILHHSTTVNIKGNSYRLKEKVKAGLLQSPELEQT"
     atgagcagca cgcaactcgt tcgcattcag gaacgcctca agcatctcaa actctaccgg        60
     atcaacgaac aactcgagag tcggctggaa gaagcttccc ggggcaacgt gagttacggc       120
     gactttctcg atcaactcct cgacgaggag gtttcggcca agaaggagaa gaacatttcc       180
     atgcggacct cgatggcccg gttccccttc gtcaagaccc tggagagctt cgacttcgcc       240
     ttccaaccct ccatcgacaa gaaacggatc aatgaactgg ccgcctgtcg tttcattgcc       300
     aacggcgaaa acgtcatcct gctgggaccg ccgggcgtgg gcaaaactca cctggccgtg       360
     gccctcggga tcaaggcggt gaccgaggga taccgtaccc atttcaccca ggcgatgccc       420
     ctggtcgcct ccctgaccaa ggcctatgcg gaaaaccgca tcgaggagcg gctcaaattc       480
     tactgccaac ccaaactgct catcatcgac gaaatcggct atatccccat tgaccggcat       540
     ggagcccatc tgttctttca gctcatttct cggcgctatg agcgcggcgc gctgatcgtc       600
     acctccaatc gcagcttcgg ccagtggaat gaaatcttcg gcgacacggt gatcgccacc       660
     gccatcctgg accgcatcct gcatcattcc acaacggtca acatcaaagg caactcgtac       720
     cggctcaaag aaaaggtcaa agccggactt cttcaaagcc ccgaactgga gcaaacgtga       780
//

If you have problems or comments...

PBIL Back to PBIL home page