(data stored in ACNUC7421 zone)

EMBL: CP000478.PE138

CP000478.PE138       Location/Qualifiers
FT   CDS_pept        171182..172480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0140"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: dar:Daro_1705 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15842"
FT                   /db_xref="GOA:A0LEJ0"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEJ0"
FT                   /protein_id="ABK15842.1"
FT                   /translation="MKRISIIGAGPMGLACAYYLLKRGFHVDVYEKDGVVGGMSASFDF
FT                   GGLMLERYYHFICGPDEDYLGLLDEIGMLDQVRWAETRMGFYYHGKLYEWGNPRALFRF
FT                   PHLDVGTKLRYALHAFHTSRITDWRKLDREEASGWLTKWIGGSGYEILWESLFRKKFHR
FT                   FSKPLSAAWIGSRIRRVARSRKGLFSEEMGYIEKGTESFLGRLKGLIEGMGGNVFLSAP
FT                   VSRILHRNGRVSGVSVEGIDRDYDVVVSTVPLPYVLRIADDLPDSYLCAVRAVNNIGVR
FT                   CVVLRLKHPLSDYFWINVNDPGFGIPGLIEYSNLNPLRDGIVYVPHYMPTESEEWRMAP
FT                   EAVIARAFVYCRRINPALDDGWLVDARLFEYEFAQPICTPGFFSKLPPVSGIIEGLYVA
FT                   DTTHSYPEDRSINESVRIAGMLARMIANERRGL"
     atgaaacgga tttcaataat aggcgcagga cccatgggac tggcctgtgc gtattatttg        60
     ctcaagcgag ggttccacgt cgatgtctac gagaaggacg gagtcgttgg aggcatgtcg       120
     gcttcctttg acttcggagg gctcatgctg gaacgctatt atcatttcat ctgcgggccc       180
     gatgaggatt acctcggtct tctcgatgaa atcggcatgc tcgaccaggt tcgctgggcg       240
     gaaacgagga tgggcttcta ctatcacggg aagctttacg aatggggcaa tccgcgcgct       300
     ctgttccggt tcccgcacct ggacgtcgga accaagcttc gctatgccct gcacgcgttt       360
     catacgagca ggatcacgga ctggaggaag ctggaccggg aggaggcttc gggctggctc       420
     acgaaatgga tcggcggctc aggctatgaa atcctgtggg aaagcctgtt cagaaagaag       480
     tttcatcgtt tttccaagcc gttgtctgcc gcctggatcg gttcgcggat ccggagggtg       540
     gcacgctccc gcaaagggct cttcagcgag gaaatgggct atatcgagaa agggaccgag       600
     tctttccttg gccgcctcaa agggctcatt gaaggaatgg gagggaacgt ttttctcagc       660
     gccccggtga gccggatcct gcaccgcaac ggaagggtgt ccggtgtcag cgtggaaggg       720
     atcgatcggg actatgacgt ggtcgtttcg accgttccgc tcccgtatgt cctgaggatc       780
     gcggacgacc ttccggattc ctatctttgc gccgtgcgtg ccgtcaacaa cataggagtg       840
     cgatgcgtgg ttctgaggct gaagcatccg ctcagcgact acttctggat caacgtcaac       900
     gacccgggtt tcggcatacc cggcctgatc gaatattcga acctcaatcc gcttcgcgac       960
     gggatcgttt atgttcccca ctatatgccg accgaaagcg aggaatggcg catggcgcct      1020
     gaggccgtca tcgcgcgggc gttcgtctat tgccgccgga tcaatcccgc ccttgacgac      1080
     ggatggcttg tcgatgcgag actgttcgaa tatgaattcg ctcagcccat atgcacgccg      1140
     ggtttttttt cgaaactgcc tcctgtgtcg ggcataatcg aaggattgta cgtggcggac      1200
     accacccact cataccctga agaccggtcg atcaacgaaa gcgtgcggat tgccggcatg      1260
     cttgcccgga tgatagcgaa tgaacggcgt ggcctttag                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page