(data stored in ACNUC7421 zone)

EMBL: CP000478.PE139

CP000478.PE139       Location/Qualifiers
FT   CDS_pept        172461..172886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0141"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: rso:RSc0167
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15843"
FT                   /db_xref="GOA:A0LEJ1"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEJ1"
FT                   /protein_id="ABK15843.1"
FT                   /translation="MNGVAFRLKNEFCSRQFAGFLVVGGSAAILNFFCRVFLSGYLSYA
FT                   AAIVVAYLIAMVFAFVLGKCFVFQSRRSSRTAREFINFGLVNGLAVLQTLGISLLLAYV
FT                   VLPYCGVSSHGEEIAHAVGIMVPAFTSYVGHKHFTFK"
     atgaacggcg tggcctttag gctgaagaac gaattttgtt cgagacagtt cgcgggtttt        60
     ctcgtggtgg gaggttccgc ggcgatcctg aattttttct gccgggtgtt cctgagcggg       120
     tatttgtcct atgccgctgc gatcgtggtt gcgtacctga tcgccatggt gttcgcgttc       180
     gtgctgggaa aatgcttcgt gtttcagtcc cggaggagtt cgcgcacggc acgggaattc       240
     atcaatttcg gcctggtgaa cggtctcgcc gttctacaga cgctgggaat cagtctcctc       300
     ctggcctatg tggtcctgcc gtattgcggg gtttcgagcc acggggagga gattgcccat       360
     gccgtcggga tcatggtgcc cgccttcacc agttatgtgg gacacaagca cttcacgttc       420
     aagtga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page