(data stored in ACNUC7421 zone)

EMBL: CP000478.PE143

CP000478.PE143       Location/Qualifiers
FT   CDS_pept        complement(177260..178372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0145"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gsu:GSU2463 glycosyl transferase, group 1
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15847"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEJ5"
FT                   /protein_id="ABK15847.1"
FT                   /translation="MRVTMVSTSYPFDPEDWRGRFIKEMVYALAEDRAVELSLWAPPGK
FT                   IPDNVAYRPTAAEAAWLKDLLARGGIAHLIRSRTPRGFEAVFKLLWLLRRNCLRKPEAD
FT                   VAHVNWLQNVLPFWGTSIPAVVSVLGTDFGLLRVPGVTGLIRTVLRQRECLIAPNADWM
FT                   VPELEKRFGDVARVRAIPFGVDDRWFSVKPIRTPGAPRQWLVVSRVTEKKIGPLFSWGE
FT                   GLFGTDDELHLLGPMQEDLSIPGWVRYHGPTHPDALESEWFPRAAGLISVSRHDEGRPQ
FT                   VILEAMAARLPILASAIPAHRNVVRHMETGWLASSREEFAGGLEWLARPDHNEAAGASA
FT                   HDWVRREIGTWRDCADRYKTAYRMVTGVEG"
     atgcgcgtta cgatggtgag cacatcctat cccttcgatc ctgaagactg gcgcggacga        60
     ttcatcaagg aaatggttta cgccctggcc gaagatcggg ccgtcgagct ctccctttgg       120
     gcgccgcccg ggaaaatccc cgacaacgtc gcctaccggc cgacagctgc tgaagccgca       180
     tggctcaaag acttgctcgc ccggggagga atcgcccacc tgattcgctc gcgaaccccg       240
     cgcggcttcg aggcggtttt caagctgctg tggctcctgc ggaggaactg cctgcggaaa       300
     cccgaggcgg acgtggccca cgtcaactgg ctgcaaaacg tcctgccatt ttggggcacc       360
     tccattccgg ccgtcgtgag cgtgctcggc accgacttcg gattgttgcg cgtgcccgga       420
     gtcaccggcc tgatcaggac ggtgctccgg cagagggaat gcctcatcgc tcccaatgcc       480
     gactggatgg ttccggagtt ggaaaagcgc ttcggcgacg tggcacgggt ccgcgcgatt       540
     ccgttcgggg tggacgacag gtggttttcg gtcaagccga taagaacgcc gggggcaccg       600
     aggcaatggc tggtcgtgtc acgggtgacc gaaaagaaga tcggcccctt gttctcgtgg       660
     ggagaagggc ttttcggcac cgacgacgag ctgcacctgc tcggtcccat gcaggaggac       720
     ctttccatcc cgggttgggt gcgctaccac ggcccgaccc atccggatgc gctggaaagc       780
     gagtggttcc cccgcgcggc cgggttgatt tccgtgagcc ggcacgacga agggaggccg       840
     caggtcattc tcgaagccat ggcggcgagg ctgcccattc tcgcatccgc cattcccgcg       900
     caccgcaacg tcgtccggca catggaaacg ggttggctcg cgagctcgag ggaggaattc       960
     gccggcggcc tcgaatggct cgctcggccg gaccacaacg aagccgccgg tgcgagcgcc      1020
     catgactggg tcaggcggga aatcggaaca tggcgggatt gcgccgaccg atacaagacg      1080
     gcataccgga tggtgacggg ggtggagggt tga                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page