(data stored in ACNUC7421 zone)

EMBL: CP000478.PE145

CP000478.PE145       Location/Qualifiers
FT   CDS_pept        179888..180400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0147"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: gme:Gmet_3338 formylmethionine deformylase;
FT                   TIGRFAM: peptide deformylase; PFAM: formylmethionine
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15849"
FT                   /db_xref="GOA:A0LEJ7"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEJ7"
FT                   /protein_id="ABK15849.1"
FT                   /translation="MAILDICTYPDPILRQKAASVENIDEALIKLIDDMTETMYEAPGI
FT                   GLAANQVGRSLSLIVVDLQRQDEEHGLIVLINPQIVATQGEITWEEGCLSVPEYFSAVK
FT                   RHAEVVVRGYGRDGKEMEIQAGGLLAVALQHEIDHLEGRLFIDRLNPITRDIFKRKWKK
FT                   KLKEATA"
     atggccattc tggacatctg tacatacccc gatcccatct tacgccagaa agccgcctcc        60
     gtcgaaaaca tcgacgaggc gctcattaaa ttaatagacg acatgaccga aaccatgtac       120
     gaggctcccg gcatcggact ggccgcaaat caggtcggca gatcgctcag cctcattgtg       180
     gtcgacttgc agcgtcagga cgaagagcat ggcctgatcg tgctgataaa cccgcagatc       240
     gtggcgactc aaggagaaat cacctgggag gaagggtgcc tcagcgttcc cgagtacttt       300
     tccgcggtaa aacgccatgc ggaggtggtg gttcgcgggt atggccggga tgggaaagaa       360
     atggaaattc aggcaggcgg cctccttgcc gtggcattgc agcacgaaat cgatcatctt       420
     gaaggccgct tgttcatcga tcgattgaat cccatcacca gggacatttt caagaggaaa       480
     tggaagaaaa aactgaaaga ggctacagca tag                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page