(data stored in ACNUC7421 zone)

EMBL: CP000478.PE148

CP000478.PE148       Location/Qualifiers
FT   CDS_pept        182171..183520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0150"
FT                   /product="sun protein"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun) domain
FT                   protein; NusB/RsmB/TIM44; KEGG: gme:Gmet_0066 Fmu, rRNA
FT                   SAM-dependent methyltransferase:Nop2p"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15852"
FT                   /db_xref="GOA:A0LEK0"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEK0"
FT                   /protein_id="ABK15852.1"
FT                   /translation="MINARVLAFQILLHMDRDASHPDRLIRGMLGRHERLEERDRALLT
FT                   ELVYGVLRWQGRLDWHIDQLSRTRPEKIDPAVRILLRLALYQILMLDRIPDHAAVNEAV
FT                   NMAKTTQPAYLVKFVNGVLREALRRRSRWIWPEAGEEPGKYIAVTTAHPIWYVERLLHE
FT                   FGFEETLDICNANNTVAPMTLRVNALKTSIDTILQWCAEHGIDAEPSGVVPTAVRLSGL
FT                   RRDLAETSIYRDGLVQVQDEASQIVSTLVAPRAGERVLDLCAGFGGKSTHLGILMGDRG
FT                   EVVAVDNSAWKLEELRKNARRQGLRIIKPRTADLFEFSPGTEDLFDRVLLDAPCSGFGT
FT                   LRRNPDIKWRRHLKDPRRFGRIQKEMLDHAARFVKPGGALVYSACTLFQEENDAVAEHF
FT                   AASHPDWQIEPVGPDLPDACRGMASGPFFRTWPHRHQVDGFFAARLKRPA"
     atgatcaacg ccagggtctt ggcctttcag attctcctgc acatggaccg cgatgcctct        60
     caccccgatc gtctcatacg cggcatgctc ggccggcacg agcgcctcga ggaaagggac       120
     agagcgctcc tgaccgagct cgtgtatgga gttcttcgct ggcagggccg gcttgactgg       180
     cacatcgacc agctgagcag gacccgcccg gaaaaaatcg accccgccgt ccgcattctt       240
     ctgcgactcg ccctttatca gatactcatg ctcgaccgca tccccgacca tgccgccgtc       300
     aacgaagccg tgaatatggc gaaaacaacc cagcccgcgt atctcgtaaa gttcgtcaac       360
     ggggtcctgc gcgaggctct gcgccgccgg agccgctgga tatggccgga agcgggcgaa       420
     gaaccgggca agtacatcgc cgtgaccacc gcgcatccga tatggtacgt ggagcggctc       480
     ctgcacgaat tcggattcga ggagaccctc gatatctgca atgcgaacaa caccgttgcc       540
     ccgatgacgt tgcgcgtcaa tgccctcaag acttcgatcg acacgatcct ccaatggtgc       600
     gcggaacatg ggatcgacgc cgagccgtcg ggagttgtcc cgacggcggt gcgcttgagc       660
     ggtttgcgac gggaccttgc cgagacgtcc atctaccggg acggtttggt gcaggtgcag       720
     gacgaggcgt cccagatcgt ttccacgctt gtggctccca gggcagggga gcgggtgctg       780
     gacctgtgtg ccggattcgg cggcaagtcc actcacctgg gcatcctcat gggtgaccgg       840
     ggagaggtcg tcgccgtgga caattccgcc tggaaactgg aagagcttcg aaaaaacgcc       900
     cggagacagg gcctgcgcat catcaagccg cgcacggcgg acctgttcga attctctccc       960
     ggaacggagg accttttcga tcgggttctg ctcgatgcgc cgtgttcggg gttcgggacc      1020
     ctccggcgca acccggacat caaatggcgg cggcacctca aggatccccg acggtttgga      1080
     aggattcaga aggaaatgct ggaccatgcc gcacggttcg tcaagccggg gggcgccctg      1140
     gtctattccg cgtgcacgct gtttcaagaa gaaaacgatg cggtcgccga gcactttgcg      1200
     gcttctcatc cggactggca aatcgagccc gtcggtcccg atttgcccga tgcctgccgg      1260
     gggatggcgt ccggcccctt cttccgcacc tggccgcacc gccaccaggt ggacggcttc      1320
     tttgccgccc gcttgaagcg acctgcctga                                       1350
//

If you have problems or comments...

PBIL Back to PBIL home page