(data stored in ACNUC7421 zone)

EMBL: CP000478.PE150

CP000478.PE150       Location/Qualifiers
FT   CDS_pept        complement(184993..186771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0152"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1617 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15854"
FT                   /db_xref="GOA:A0LEK2"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEK2"
FT                   /protein_id="ABK15854.1"
FT                   /translation="MSNERKTFLFGLIALTSISLALRLHDLDAESLFMDEARQISYYAL
FT                   SLRDIITYAATQVQPPLDYWIGHAVFLIDRSVFAARLPAALFGVGSVGLLAILLSRYCS
FT                   WQVSLLTGLLMAILPFHLYFSQEARPYSIVMFLLLVVLWQLDNFMRDSSLRARHLLALP
FT                   GACVLFLYSSGLSPLMVIVALFSVLGAPVLVSLVRPGRLAPERRKRSLAAMGTICIAIG
FT                   LYLPIFFILVQTSRRYAPHLSKADPAIYLTHLLNFSFFPLWRAYVTQLEPIGLLLLPFV
FT                   LAAIVLAIKRRGEPGFFLPKIVAATLPCAAVLHLFAYGANTESPFRPPYPMYILPLTLF
FT                   LAACAWHELASRLQAVKIPGRRVLLASITVLMFVFVLHSTWAFKTMRRKADVNGIREYI
FT                   AGVRHPGTVFFTGGLVGFGGWYPEFELGKSPHCPLEALPLVDDRRLLSEGEPVFLFFTF
FT                   HEYFLTPFSKYPIVPIPGDKTPLPLERLRNSPVLSCAEYIGYEGVRLKNPSGRLAEDAF
FT                   RIAEAILEQLPDNNALVDLRVATAKLGRALGRTDYEEHIRKSMAVLDPSERAVLTARLL
FT                   RASPPMIAHPKESNQP"
     atgtcgaatg agcggaagac ttttctgttc ggactcattg cactgacctc gatctccctg        60
     gctctccgtc tgcacgattt ggacgccgaa agtctcttca tggacgaggc gcgccagata       120
     tcctattatg cgctcagcct gcgcgatatc atcacctacg ccgccaccca ggttcaaccg       180
     cctctcgact actggatcgg ccacgcggtg tttctcatcg accggagcgt cttcgccgcg       240
     cggctgcccg ccgcgttgtt cggggtgggt tcggtcggcc tgcttgcgat actgctctca       300
     agatactgtt cctggcaagt cagcctcctg accgggctcc tgatggccat actgccgttt       360
     cacctgtatt tctcacagga agcacggccc tactccatcg tgatgtttct tctgctcgtg       420
     gtcctgtggc agttggataa tttcatgcgg gattcctcgt tgagggcgcg acatttgctc       480
     gcgctgccgg gtgcctgtgt cctgttcctg tactccagcg ggctctcgcc gctgatggtg       540
     atcgtggcgc tgttttcggt tctcggggca ccggttctcg tttcactggt gcgcccgggc       600
     cggctcgccc cggagcgccg aaaacgcagc cttgccgcca tgggaacgat ctgcatcgcc       660
     atcggcttgt atttgccgat ttttttcatc ctggtccaga catccaggcg atacgccccg       720
     catctttcca aggcagatcc ggccatttac ctgacgcatc tcttgaactt ctcgttcttt       780
     cccttgtgga gggcctatgt gacgcaattg gaacccatcg gccttctgct tttgcctttt       840
     gtcctggcgg cgattgtcct ggcgatcaaa cgaagaggcg agcccggatt cttcctgccc       900
     aaaatcgtgg ccgccacgct cccgtgtgcg gccgtcctgc atcttttcgc ctacggcgcc       960
     aacaccgagt ctccgttccg acctccctat cccatgtaca tcttgcccct gacgctgttt      1020
     cttgccgcct gcgcatggca tgaactcgcg tcccgacttc aagccgtcaa gataccggga      1080
     cggcgcgtac tgcttgcctc catcacggtc ctgatgtttg tgttcgtcct tcattccaca      1140
     tgggccttca agacaatgcg gaggaaagcc gacgtcaacg gaattcgaga atacatcgca      1200
     ggcgtccgcc acccgggcac cgtgttcttc acggggggcc tggtagggtt cggcggctgg      1260
     tacccggaat tcgaactggg caagtccccg cactgtcccc tggaagcgct tccgctggtc      1320
     gatgatcggc gcttgctctc ggagggcgaa ccggtgttcc tcttcttcac ctttcacgag      1380
     tatttcctga cgccgttttc gaaatacccg atcgttccca ttcccggcga caaaacaccg      1440
     ttgcccctgg aaagacttag gaacagcccg gtcctctcct gcgccgaata catcggctac      1500
     gagggcgtcc ggctgaagaa cccgtccggg cgacttgccg aggatgcctt caggattgcg      1560
     gaagccatcc tcgagcaact cccggacaac aacgcgctgg tcgatctgcg tgtggcgacg      1620
     gccaagcttg ggcgcgcatt ggggcggacc gactacgagg agcacatccg gaagtccatg      1680
     gccgtcctcg acccctcgga acgggccgtt ctgaccgccc ggctcctgcg ggcctcccct      1740
     cccatgatcg ctcatccgaa ggaaagcaac caaccatga                             1779
//

If you have problems or comments...

PBIL Back to PBIL home page