(data stored in ACNUC7421 zone)

EMBL: CP000478.PE151

CP000478.PE151       Location/Qualifiers
FT   CDS_pept        186884..187156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15855"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEK3"
FT                   /protein_id="ABK15855.1"
FT                   /translation="MKEKHGTCAGRSVGAGTGRQRGAGRGGHSIESVGTARLPVDPMRR
FT                   RARPGGGRPAGKKAARRGFECSSMRSARAMCFKRLSSRPGQVFPW"
     ttgaaggaaa aacacggcac ttgcgccggg aggtccgtcg gcgcgggaac cgggcggcag        60
     aggggagcgg gccgtggcgg gcactcgatt gagagcgtcg gcacggcgcg gctgccggtc       120
     gacccgatgc gccgccgcgc gcgcccgggg ggaggccgac ccgccggaaa gaaggcggca       180
     cgccggggat tcgagtgctc atccatgcga tcggcaaggg cgatgtgttt caagagactc       240
     tcaagccggc cgggacaggt ttttccgtgg tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page