(data stored in ACNUC7421 zone)

EMBL: CP000478.PE152

CP000478.PE152       Location/Qualifiers
FT   CDS_pept        complement(187113..189023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0154"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="TIGRFAM: methionyl-tRNA synthetase; methionyl-tRNA
FT                   synthetase, beta subunit; PFAM: t-RNA-binding domain
FT                   protein; KEGG: sat:SYN_00558 methionyl-tRNA synthetase /
FT                   protein secretion chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15856"
FT                   /db_xref="GOA:A0LEK4"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEK4"
FT                   /protein_id="ABK15856.1"
FT                   /translation="MNRFYITTPIYYVNAEPHIGHAYTTIVADVMNRFHKLMGFGTFFL
FT                   TGTDEHGDKIVQAAADAGTAPKEYADRISGMFKEAWSKLNISNDHFIRTTDPEHIRVVQ
FT                   HILQQVYDSGDITFSTYRGLYCVGCERFYTERELVDGKCPDHDKEPIEREEANYFFRMS
FT                   KYQNWLIEHIESNPDFIRPERYRNEVLAFLREPLEDLCISRPKERLAWGITLPFDERYV
FT                   TYVWFDALINYVSALGYPDGPLFGEFWPVVQHTIAKDILKPHGIYWPTIIKAAGFPVYR
FT                   HLNVHGYWKINEGKMSKSRGTVVRPLDMIPLYGLDAFRYFLLREMVFGLDANFSEDALV
FT                   QRLNSDLANDLGNLFSRTLAMTLKYFDGKVPPFGSEPDDMDRDLISRVERTVAEFREEL
FT                   PVFCFHKALMSIWECLNAANKYIDTVGPWGLAKDPSRHGRLETVIRILLELNKTMAVLI
FT                   SPFMPSTSEKMLERLGVVKRSIDLRLAEDGRWGTLVEGTPVSKGDALFPRIDIKEERKP
FT                   AVPRQPEKRQPSLPLLDLEAFKQVDLRTGVVKHAERVPKSEKLLRLLVDIGEERQVVAG
FT                   IAQSYSPEELTGKQVVVVANLKPAKLMGIESHGMVLAVRDGDALRLLTTEKPVPAGLRV
FT                   S"
     atgaatcgtt tctacatcac cacccccatc tactatgtga atgccgaacc gcatatcgga        60
     cacgcttaca ccaccattgt ggcggatgtg atgaatcgtt tccacaagct gatgggattc       120
     gggacattct ttctcaccgg cacggatgag cacggcgaca agatcgtcca ggcggccgcc       180
     gatgccggta cggctcccaa ggaatatgcc gaccgcatca gcgggatgtt caaggaagcc       240
     tggtcgaagc tcaacatcag caacgaccac tttatccgca ccacggaccc ggaacacatc       300
     cgggtggttc agcacatcct ccagcaggtt tacgactcgg gagacatcac cttcagcacg       360
     taccggggcc tatactgcgt gggttgcgag cgtttttaca cggaacgcga gctggtggac       420
     ggcaaatgcc ccgatcacga caaggaaccg atcgagcggg aggaagcgaa ttattttttt       480
     cgcatgagca agtatcagaa ctggctcatc gagcatatcg agtcgaaccc ggattttatc       540
     aggccggaac ggtatcgcaa cgaagtgctt gccttcctga gagaacccct cgaggatctt       600
     tgcatctcca ggcccaagga acggctcgcc tgggggatca ctctgccctt cgacgagcgt       660
     tacgtgactt acgtctggtt cgacgcactg atcaactacg tatccgctct cggatacccc       720
     gacggaccgc tcttcggaga attctggccc gtggtgcaac acaccatcgc caaggacatc       780
     ctcaaacctc acggcatcta ctggccgacc atcatcaagg cggcgggctt cccggtttat       840
     cgacacctca acgtccacgg ctactggaag atcaatgagg ggaagatgag caagagcagg       900
     gggacggtgg tgcgaccgct ggatatgatc cccctctacg ggctcgacgc ctttcgttac       960
     ttcctgcttc gcgaaatggt gttcggcctc gacgccaact tcagcgagga cgccctggtg      1020
     cagcgtttga attccgacct ggccaacgac ctgggcaatc ttttcagccg gacgctggcc      1080
     atgacgctca agtatttcga cggcaaggtg cctcccttcg gctccgaacc ggacgatatg      1140
     gaccgggacc tcatctcccg ggtcgaacgg accgttgcgg agttccgcga ggagcttccg      1200
     gtattctgct tccacaaggc tctgatgtcc atatgggaat gcctgaatgc cgccaacaag      1260
     tacatcgata ctgtcggccc ctgggggctt gccaaagacc cgagccggca cggccgcctc      1320
     gagaccgtga tccggattct gctcgaactg aacaagacca tggcggtgct gatctccccg      1380
     ttcatgccgt ccacttccga aaagatgctc gagcggctgg gcgtggtgaa gcgttccatc      1440
     gatttgaggc tcgctgaaga cggccgctgg ggcaccctgg tcgaggggac cccggtttcc      1500
     aagggagatg cgttgtttcc ccggatcgac atcaaggagg aacgaaaacc cgccgtcccc      1560
     cggcaacccg agaaacggca gccgagcttg cccctcctgg acctggaagc attcaagcag      1620
     gtggatttgc gcaccggcgt ggtgaagcat gccgaacgag tcccaaaatc cgagaagctg      1680
     ctgcggttgt tggtggatat cggtgaagag cggcaggtgg tcgccggaat cgcccagagc      1740
     tattcgccgg aggagctcac gggcaaacag gtcgtcgtgg tggcaaattt gaaacctgcc      1800
     aagctgatgg gtatcgagtc ccacggaatg gtcctggccg tcagggatgg cgatgcgctg      1860
     cgccttctca ccacggaaaa acctgtcccg gccggcttga gagtctcttg a               1911
//

If you have problems or comments...

PBIL Back to PBIL home page