(data stored in ACNUC7421 zone)

EMBL: CP000478.PE153

CP000478.PE153       Location/Qualifiers
FT   CDS_pept        complement(189187..189984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0155"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: cpe:CPE2448 signal
FT                   peptidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15857"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEK5"
FT                   /protein_id="ABK15857.1"
FT                   /translation="MEKVVGIRFRKGGKIYHFDPSEYALKKGDFVMVHTEQGIGLGQVA
FT                   EGPHGKDPRFHPSEVKKIDRPATTEEIRTHQNNLEVEQDAKNYCLDRIKAHQLAMSLVD
FT                   VEYFFDGSKIIFYFTADGRVDFRELLKDLVRRLRTRVELRQIGIRNQAKMVGGLGNCGR
FT                   PLCCATFLKNFHAVSIKMAKEQNLSLNPTKISGACGRLMCCLQYEYDTYRELKKDMPKL
FT                   GKKVEIPEGRGKVIRQNVMERSVTVLMEDGREIEKQLDPPPKG"
     atggaaaagg ttgttggaat ccgcttccgt aaaggaggca agatatatca tttcgaccct        60
     tcggaatatg ctttgaaaaa gggcgatttc gtaatggttc acactgaaca gggcatcggg       120
     ctgggacagg tcgcggaagg cccgcatggc aaagatccca ggtttcatcc ctcggaggtg       180
     aagaaaatcg accgccctgc aacgacagag gaaatccgga ctcaccagaa caatcttgaa       240
     gtcgaacagg acgccaagaa ctactgtctg gatcgcataa aggcacacca actcgccatg       300
     agtctcgttg acgtcgaata cttcttcgac ggcagcaaaa tcattttcta ttttacggcg       360
     gacggccggg ttgatttcag ggagctgctt aaagatctcg tcaggcgatt gaggaccagg       420
     gtggaactgc ggcaaatcgg catccgcaac caagccaaga tggtcggtgg tcttgggaat       480
     tgcggccgcc cgttgtgctg cgccactttc ctcaagaatt tccacgcggt ttccatcaag       540
     atggcgaagg agcagaacct cagcctgaat cccaccaaga tttctggtgc ctgcggaaga       600
     ttgatgtgct gcctgcaata cgaatacgat acctacaggg aactcaaaaa agacatgccg       660
     aaactcggca agaaggtgga aatcccggaa ggacgcggga aggtgatccg ccagaatgtg       720
     atggagagat cggtcaccgt cctgatggag gacgggcgcg agatcgaaaa gcaactagac       780
     cccccgccga aaggctga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page