(data stored in ACNUC7421 zone)

EMBL: CP000478.PE154

CP000478.PE154       Location/Qualifiers
FT   CDS_pept        complement(189953..190960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0156"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, delta prime subunit;
FT                   KEGG: sat:SYN_02985 DNA polymerase III, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15858"
FT                   /db_xref="GOA:A0LEK6"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEK6"
FT                   /protein_id="ABK15858.1"
FT                   /translation="MSFKDIPGQERTKRLLKRMARAGTLPHAVLFSGMAGVGKLRVARE
FT                   LAKLVNCLEPRDDESCDRCISCRKIDEGHHPDLFVIRSEGTFIKLDRIRELRERVRFRP
FT                   FEGRFRVVIIENAQHLHDESGNALLKVLEEPPRANLFLLTAIEPQMLLPTIVSRCSHLR
FT                   LQPLEDEVIAGELAASLKIPEAQARELTRLSGGSLDRAQWLAREEHLSHWKEIVENLRK
FT                   SERSGTADVLAMAGRWAQQKEDLEQDLECVKLWVRDLLLSRVIDGYRQAFEPDDPCAVC
FT                   GGEVSPDSLLTLYDRVEESIGRLRGNANKQLVMESICLNIKDVLYGKGCWNPLP"
     atgtcgttca aagatattcc cgggcaggaa cgaacgaagc ggctgctgaa gcggatggcg        60
     cgagccggaa cgcttccgca tgcggttctg ttcagcggca tggcgggcgt gggcaagctg       120
     cgggttgccc gggagctcgc caagctggtc aactgtctcg aaccccggga cgacgagagt       180
     tgcgatcgct gcatttcatg ccgaaaaatc gatgaagggc atcatccgga cctttttgtc       240
     atccggagcg agggcacgtt catcaaactg gaccggatcc gggaattgcg ggagcgcgtt       300
     cgcttccgtc ccttcgaagg cagatttcga gtcgtcatca tcgagaatgc ccaacacctc       360
     catgacgagt ccggcaatgc cctgctcaag gtgctcgagg agccgccgcg cgcaaacctt       420
     tttctcctta cggccattga gccccagatg ctcctgccga caatcgtgtc gcggtgcagt       480
     cacttgcggc tgcagccgct cgaagacgag gtgatcgcag gggagctggc cgcttccctg       540
     aagatccccg aggcgcaggc acgggagctg acccggctgt cgggaggcag tctcgacagg       600
     gcacagtggc tggcacggga agaacacctg tcccactgga aggagattgt cgagaatctc       660
     cggaaatccg agcggagcgg cacggccgac gttctcgcca tggcggggcg atgggcccaa       720
     cagaaggaag acttggagca ggatctggaa tgcgttaaat tgtgggtgcg ggatctcctg       780
     ctctcccgcg tgatcgacgg ttacaggcag gctttcgagc cggatgaccc gtgcgccgtt       840
     tgcggtgggg aggtttctcc cgacagtctg ttgacccttt acgaccgggt cgaagagtcg       900
     atcggtcgtt tgcgcgggaa cgccaacaag cagctcgtca tggaaagcat ctgcctgaac       960
     ataaaggatg tcttatatgg aaaaggttgt tggaatccgc ttccgtaa                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page