(data stored in ACNUC7421 zone)

EMBL: CP000478.PE155

CP000478.PE155       Location/Qualifiers
FT   CDS_pept        complement(191014..192060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0157"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: sat:SYN_02192 HD-superfamily hydrolase;
FT                   TIGRFAM: metal dependent phophohydrolase; PFAM: nucleic
FT                   acid binding, OB-fold, tRNA/helicase-type; metal-dependent
FT                   phosphohydrolase, HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase, HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15859"
FT                   /db_xref="GOA:A0LEK7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEK7"
FT                   /protein_id="ABK15859.1"
FT                   /translation="MSKTFIADIQPNQDIAAAFVVSEKQLRTTRSGTAFLTLRLVDRTG
FT                   EITGRVWDNAAELAAVIPLKGAVFLRGRSETYRDEMQLNIQEARPLKPEAVDPADFLPV
FT                   CPTDRDVLFEKLSGRISEVEDRPCKQLLKAIFKDRVLLSRFKSAPAAKSMHHAYLGGLL
FT                   EHTLSVVELVLRICRLYPFLDRDLLVAGAILHDIGKTDEYVYDLAIDYSHSGRLLGHMV
FT                   LGVQIVDEKLRLLKDFPEEKAWLIKHMILSHHGEAEFGAAKLPMTREAFVLHHADDLDA
FT                   KMNNLTRILSEPKMGNEVWTAYQPLFERFFYRGLPKEQAETPPLEGEETEDERGVQLNL
FT                   WNPEKPKK"
     gtgtcgaaga cctttatcgc cgacattcag cccaaccagg atatcgcggc ggctttcgtc        60
     gtgagcgaga agcagctgcg gaccacccgc tccggaacgg cgttcctcac gcttcggctt       120
     gtcgacagga cgggagagat caccggccgt gtctgggaca acgcggcgga gcttgccgcc       180
     gtcatccctc tcaagggagc ggtgttcctg cgcggtcgca gcgagacgta tcgggacgaa       240
     atgcagttga acatccagga agctcgtcca ctgaaaccgg aagccgtcga cccggcggat       300
     ttcctcccgg tgtgcccgac ggaccgggat gttctgttcg agaaactgag cgggcgcata       360
     tcggaggttg aagaccggcc ctgcaaacag ctgctcaaag ccatcttcaa ggatcgggtt       420
     ctgctgtccc ggttcaagtc ggcaccggcg gccaaatcga tgcaccatgc ctatctcggg       480
     gggttgctcg aacatacgct ttccgtcgtg gaactcgttc tccgcatctg ccggctgtac       540
     ccgtttctcg accgggacct gctcgtggcc ggcgccatat tgcacgacat cgggaagacc       600
     gatgagtacg tttacgacct cgccatcgac tattcccact ccggccgttt gctgggccac       660
     atggttctcg gcgtccagat cgtggatgag aaacttcgtc ttttgaagga ctttcccgag       720
     gaaaaagcct ggctgatcaa gcacatgatt ctcagccacc acggcgaggc ggaattcggt       780
     gccgcgaagc tccccatgac gagggaggcc ttcgtccttc accacgccga cgatctggac       840
     gcgaagatga acaacctgac ccggatcctg tcggagccca aaatggggaa cgaggtgtgg       900
     accgcctacc aaccgctgtt cgaacgattc ttctaccgtg gcctgcccaa agagcaggcg       960
     gaaaccccgc ccctcgaagg ggaagagact gaagatgaac gaggggttca gctgaatctc      1020
     tggaacccgg aaaaaccgaa gaagtaa                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page