(data stored in ACNUC7421 zone)

EMBL: CP000478.PE157

CP000478.PE157       Location/Qualifiers
FT   CDS_pept        192519..192881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15861"
FT                   /db_xref="GOA:A0LEK9"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEK9"
FT                   /protein_id="ABK15861.1"
FT                   /translation="MSQKGERALSGFPLRAVMRAAADRWIVLRGLSERSPLVAVLLTKR
FT                   RHGVEECLMPLNIVALIAILSLPLVPTFWAILDIPKRRFASPRKKAVWFAIVSTFPFIG
FT                   AMIYIILIRRHTEPIS"
     gtgtcgcaga agggcgaaag ggcgctttca gggtttcctc ttcgggctgt catgagagcc        60
     gctgcggacc ggtggattgt ccttcgcggc ttgtccgagc gcagcccgtt ggttgcggtt       120
     cttctcacga aacgccgaca cggcgtcgag gagtgtctga tgcctttgaa tatcgtggca       180
     ttgatcgcga ttttgagtct tccgctcgta cccactttct gggcgattct ggatataccc       240
     aaacgccgct ttgcaagccc ccggaaaaag gccgtgtggt tcgcgatcgt gtccactttc       300
     cctttcatcg gagccatgat ctatattatc ctgattcgcc gtcacaccga acccatctcg       360
     tag                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page