(data stored in ACNUC7421 zone)

EMBL: CP000478.PE159

CP000478.PE159       Location/Qualifiers
FT   CDS_pept        complement(194949..195557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0161"
FT                   /product="Dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="KEGG: bld:BLi03054 similar to proteins; RBL01877;
FT                   TIGRFAM: dephospho-CoA kinase; PFAM: Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15863"
FT                   /db_xref="GOA:A0LEL1"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEL1"
FT                   /protein_id="ABK15863.1"
FT                   /translation="MRVNAKRIALTGGIASGKSTVARMFADRGALILDADVAAREAVEP
FT                   GSECWQRLREWLAPAFFDAEGRLDRRRLRDLIIRDPQCLVRLNAILHPFIFARMESQWR
FT                   REIEARTRRVVIFDIPLLFESHAADRFDIVILVHVPPEIQIGRLMKRDGLTRAEAEKTL
FT                   EIQLPIDSKIPLSQIVIDNSLDLDHTSRQVLDAWNRIAS"
     gtgagagtga atgcgaagag gatcgccctg acggggggaa ttgcctcggg caagagtacc        60
     gttgcccgaa tgttcgccga ccgtggagcg ctcatcctcg atgcggatgt ggcggctcgc       120
     gaggcggtcg agcccgggtc ggagtgctgg cagcggttgc gtgagtggct cgcacccgct       180
     tttttcgatg cggaaggacg cctcgatcgg cgcagactgc gggatctgat tatccgcgat       240
     ccgcagtgcc tcgtgcgttt gaatgcaatc ctgcaccctt ttattttcgc ccgtatggaa       300
     tcccaatggc gccgggagat tgaggctcgc acgaggcgtg tggtgatctt cgatattccg       360
     ctgttgttcg aatcacatgc cgcggaccgc ttcgatattg tcattctggt tcatgtgcct       420
     cccgaaattc aaatcgggag gctcatgaag cgcgacggtc tgacccgcgc cgaagccgaa       480
     aaaaccctcg aaatccagct tcccatcgat tcaaagatac ccttgtcgca gatcgtcatc       540
     gacaacagtc tcgacctcga ccatacgtcg cgccaggtcc tggatgcctg gaacagaatt       600
     gcgtcctga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page