(data stored in ACNUC7421 zone)

EMBL: CP000478.PE160

CP000478.PE160       Location/Qualifiers
FT   CDS_pept        complement(195589..195915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15864"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEL2"
FT                   /protein_id="ABK15864.1"
FT                   /translation="MKKKMHLLFIIPLLFGLLCTPVWAETLAPEPVSQRAQMLYESPPA
FT                   ELILADVFILRPAGIVATALGLAGSIVAYPFGVTSCSTEIIDQKLVREPWDYTFCRPVG
FT                   RIDY"
     atgaagaaga agatgcacct gctgttcatc attcccctgc tgttcgggtt gctctgcacc        60
     ccggtctggg ccgaaacgct ggcccccgag ccggtttcgc agcgggccca gatgctctac       120
     gagtcaccgc cggcggagct tatcctggcg gacgtcttta ttctgagacc ggcgggtatc       180
     gttgccacgg cccttggact ggcgggcagc atcgttgcct accccttcgg cgtgacgagc       240
     tgcagcaccg aaatcatcga tcaaaagctg gtccgggaac cttgggatta cacattctgc       300
     cggccggtgg gacgcatcga ttactga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page