(data stored in ACNUC7421 zone)

EMBL: CP000478.PE163

CP000478.PE163       Location/Qualifiers
FT   CDS_pept        198297..199985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0165"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_2371 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15867"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEL5"
FT                   /protein_id="ABK15867.1"
FT                   /translation="MAQVLDLEEKRLGKLSPRDLAGELMKVPAKKRLELILQRSDAASV
FT                   VAAMEVRDYYFSVMEIGPDDALPLLAMANVEQLIHLFDLEWWEADRVKVSRAIEWLERI
FT                   EKANERNLLEWLYKVDFELLVILFKKWIRVQLMPDDTDPVEAREQLPRNTIDDVYFWEA
FT                   LYPQYEDLINRMLSLLFEAHPGFYRELMNAAIWALDPEMEEDAYRFHRGRMEDQAIPDF
FT                   YDALEVYRSIGLREIKADKQPFESPSEEFRPPAFALALIPEGDLLDRALQEVRRKSSLD
FT                   LVQMELASLANKVIVADRLPPEEPEMLRRAVEKTVACVNLGLELLSDGDLAVAVGAVEN
FT                   IHLEQLFRLAQTEIGNLRNRLLELLRGGWLSRWPEGIRCLDREWLERAELLIRRTPKLL
FT                   RPASTAGARSGEDFFRRESDLLEAGRFIESVSRIGRLYAALMPDPDLLDRKLWRGGQIG
FT                   SLAEVTLGSMILTSASRAVLDGQWRLDLIPLERWPVLFGLARPETLRKVIVQWAQTVLP
FT                   DNDLQGGVLEYLDSVLVAFREDMSGFTSSDPPDPRNVPLLLFTQG"
     atggctcagg ttctggatct tgaagaaaaa cgactgggaa agctgtcccc gcgggacctt        60
     gccggggagc tgatgaaggt tccggccaaa aagaggctgg agctgatcct gcaacgcagc       120
     gatgcggctt ccgtggtggc cgcaatggaa gtgcgggatt actatttttc ggtcatggag       180
     atcggccccg acgatgcact gccgcttctg gccatggcca atgtcgaaca actgatccat       240
     ctgttcgatc tcgaatggtg ggaggcggac cgggtcaagg tctccagagc catcgagtgg       300
     ctggaacgca tcgagaaggc caatgaacgc aatctcctgg aatggcttta caaagtcgat       360
     tttgagctgt tggtgatcct tttcaagaaa tggatccggg tgcagttgat gcccgacgac       420
     acggatcccg tcgaagcaag agagcaactc ccgcgcaaca ccatcgatga cgtgtatttc       480
     tgggaagcgc tctacccgca gtacgaagat ctgatcaacc gtatgctgag tctccttttc       540
     gaagcgcatc ccggctttta ccgggagctc atgaacgccg cgatctgggc tttggacccg       600
     gaaatggaag aggacgccta ccggtttcac cgcggccgga tggaagacca ggccatcccc       660
     gacttctacg atgcgttgga ggtctaccgc agcattggcc tgcgggaaat aaaagcggac       720
     aagcagcctt tcgaatcgcc ttctgaagaa ttccgcccgc cggctttcgc tctggccctg       780
     attcccgagg gtgacctgct ggatcgcgcg cttcaggaag tgcgtcggaa gtcgtcgctc       840
     gatctggttc agatggagct ggcatcgctg gccaacaaag tgatcgtcgc cgaccggctc       900
     ccgcccgaag aacctgaaat gctgcggcgg gcggtggaaa agacggtggc ctgcgtcaac       960
     ctgggtctcg agcttctgag cgacggagac cttgccgttg ccgtcggcgc ggtcgaaaac      1020
     attcatctcg agcagttgtt tcgtctggcc cagacggaga tcggcaacct gcggaaccgc      1080
     ctcctggagt tgctccgggg cggatggttg tcccggtggc cggaggggat caggtgcctg      1140
     gatcgggaat ggctggaacg ggccgaactg ctgattcgca ggacaccgaa gctgttgaga      1200
     ccggcctcaa cggcgggagc ccggagcggt gaggactttt tccgtcgcga aagcgacctg      1260
     ttggaggcgg gccgttttat tgaaagcgtt tcccggatcg ggcggctgta cgccgcactg      1320
     atgcccgatc ccgacctgct ggatcgcaaa ctttggcgcg gcggtcagat aggaagcctt      1380
     gccgaagtga ctctcggatc gatgatcctg acgtcggcct cacgcgccgt tctcgatggc      1440
     cagtggaggc tcgacctcat ccccttggaa cgatggccgg ttctgttcgg cctcgctcgg      1500
     ccggagaccc tccggaaggt gattgtccaa tgggcgcaaa cggttcttcc ggacaatgac      1560
     ctccagggag gcgtcctcga atacctcgac tcggtcctcg tcgccttccg ggaagacatg      1620
     tcgggcttca cctcttccga tcctcccgat cctcggaacg tgccgctgct tctcttcacg      1680
     cagggatag                                                              1689
//

If you have problems or comments...

PBIL Back to PBIL home page