(data stored in ACNUC7421 zone)

EMBL: CP000478.PE164

CP000478.PE164       Location/Qualifiers
FT   CDS_pept        complement(200007..201329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0166"
FT                   /product="RNA modification enzyme, MiaB family"
FT                   /note="KEGG: sat:SYN_00797 tRNA 2-methylthioadenosine
FT                   synthase -like protein; TIGRFAM: RNA modification enzyme,
FT                   MiaB family; MiaB-like tRNA modifying enzyme; PFAM: Radical
FT                   SAM domain protein; Protein of unknown function
FT                   UPF0004-like; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15868"
FT                   /db_xref="GOA:A0LEL6"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEL6"
FT                   /protein_id="ABK15868.1"
FT                   /translation="MTSKKVAVETLGCKVNQYESSVMMESLMQANWQPVSFKGAADLYV
FT                   VHSCAVTSSAAFQTRQLLRRARRLNPGALIAVVGCDAQLDHDRLAAGELATHILGTAEK
FT                   FDIARWIEVPASFAAPCRAVKGVNDIPRLSAQAVSCMHTGRTRAYLKVQDGCNAYCSYC
FT                   VVPYTRGRSRSLPADEVLSRLRRFVEVGYREVILTGIHLGQWGKDLTPTRDLAGLLDRI
FT                   GDSDSPPRVRLSSLEPLEWSAGLLRRISTVPWICPHFHIPLQSGDDDVLAAMHRPYTAL
FT                   QYANLIRELRMLFPEAALGADVMVGFPGETQRRFLNTLHLVEELPLTYLHVFPFSPRPG
FT                   TPAADMPGRIPGDETKKRARLLQDIGTRKRRQFSERFLGRSVEVLVESAAPRAGWLRGT
FT                   TANYLQVLFPAGPPVLPGSIVRVQVVRSGDRELIAAAPAGG"
     ttgacgtcga aaaaagtggc cgtggagact ctgggctgca aagtgaacca gtacgagtct        60
     tccgtaatga tggaatcctt gatgcaggcg aactggcagc cggtttcatt caaaggcgcg       120
     gccgacctct acgtcgtcca cagttgcgcg gtgacttcca gtgccgcgtt ccagacgcgg       180
     caactgctcc gccgcgcacg gcgactgaat cccggagcat tgatcgccgt ggtgggttgc       240
     gatgcgcaac tcgaccacga ccggttggcg gccggagagt tggccacgca catcctgggc       300
     acggcggaaa agttcgacat cgcgcgatgg atcgaggtac ccgcaagctt tgccgcgccg       360
     tgtcgcgccg tgaagggtgt gaacgacatc ccgcgtttga gcgcccaggc ggtttcgtgc       420
     atgcacaccg gacgcactcg tgcttatctg aaggttcaag acggctgcaa cgcgtactgt       480
     tcctattgcg tggtcccgta cacgcgcggc cgcagccgca gcctgccggc cgacgaagtt       540
     ctttcccggt tgcgccggtt cgtcgaggtg ggatatcggg aggtcatcct caccgggatc       600
     catcttggcc agtggggaaa agacctgaca ccgacccggg acctggccgg actgctcgat       660
     cgcatcgggg attccgactc gccgccccgg gtgcgcctca gttccctcga acccctggag       720
     tggagtgccg gtctcctgcg caggatttcc accgtcccct ggatttgccc tcacttccac       780
     attccattgc agagtggaga cgacgatgtt ctggccgcca tgcatcgccc ctatacggca       840
     ctacaatacg cgaacctcat ccgggagctc cgcatgttgt tccccgaggc cgccctgggt       900
     gccgatgtga tggtgggctt cccgggagaa acgcaacgcc ggttcttgaa cacgctccac       960
     ctggttgagg agctccccct cacctacctg cacgtattcc ccttctcacc ccgcccgggt      1020
     acgcccgccg cggacatgcc cggcagaatt ccgggtgacg agacgaaaaa gagagcccga      1080
     ctgctgcagg acatcggcac aagaaagcga aggcaattca gcgagcggtt cctcgggcga      1140
     agcgtggagg tactcgtgga atcggccgcg ccccgtgccg gctggctgag gggtaccacc      1200
     gcgaattatt tgcaggtttt gttcccggca ggtccacccg tgcttcccgg ctccattgtc      1260
     cgggtgcagg tcgttcgatc cggggaccgc gaactgatcg ccgcggctcc ggcaggcggg      1320
     tga                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page