(data stored in ACNUC7421 zone)

EMBL: CP000478.PE166

CP000478.PE166       Location/Qualifiers
FT   CDS_pept        complement(202592..203017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0168"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: sat:SYN_00800 ferridoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15870"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEL8"
FT                   /protein_id="ABK15870.1"
FT                   /translation="MYARMLVLRFPKDIVDKPIITYLVRDYNLTFNILKAQIYPRKEGM
FT                   LVLELRGSKRDYDKGIKFLKQVGVVIEPVAQGIRRDDDRCYQCGACTAVCPTGALRIKR
FT                   PEMAVLFESERCSACELCVKTCPARAMIVTFDKTLAL"
     atgtatgcca gaatgctggt cctgcggttt cccaaggaca tcgtggacaa acccatcatc        60
     acctacctgg tgcgtgacta taacttgacc ttcaatattc tgaaggcgca gatatacccc       120
     cgcaaggagg gcatgctggt gctcgaactg cggggaagca aacgggacta cgacaaggga       180
     atcaagttcc tgaagcaggt cggagtcgta atcgaaccgg tcgcgcaggg aatccggcgc       240
     gatgacgaca ggtgctacca gtgcggcgcc tgcacggcgg tttgtcccac gggcgcgctt       300
     cgcatcaagc gaccggagat ggcggtgctc ttcgaatccg aacggtgcag cgcttgtgag       360
     ctctgcgtga aaacttgccc ggcccgagcc atgatcgtga cgttcgacaa gaccctggcg       420
     ctatag                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page