(data stored in ACNUC7421 zone)

EMBL: CP000478.PE168

CP000478.PE168       Location/Qualifiers
FT   CDS_pept        complement(204808..205995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15872"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEM0"
FT                   /protein_id="ABK15872.1"
FT                   /translation="MNIKQGPRESTSGWLALIGLASLLIWPCPSAHAQANKPLAAGPPP
FT                   VPVRILLAIPDEFASFSYASLIRGRETRHLFGAEAQAAFKNMIAPEFMVFKTRRVSSPA
FT                   AAMAMLSPGDPNNAQTREFDYLAIPRFARVNVSARGRKYGFDVDILVDFHATDGRTITT
FT                   IEGHGESTTGVHFSISPQEAGNLALRCSMEALRDAIIGRRELFVPIRARVEPPREESSR
FT                   SGPQAGRGSAPLPVKVLLAVPDEFSRYAHQIDPGEGGIENDIGGEAERQFRIILSPGFE
FT                   TLVIRPTESESAAMELLSSHSPANIDARGFDYVAIPRFTRIDSRVRGSHYMFSAEIQLR
FT                   FYPVSGLREVTIKGLGKYEGDLDGGAAEEATGRAIKTAVKAIRESIDQRHDLFLP"
     atgaatatca aacaaggtcc ccgtgaatcg acttccggat ggctggcttt gatcggtttg        60
     gcatctttgt tgatatggcc ctgcccgtcc gcccacgccc aggccaacaa gcccctggcc       120
     gccggcccgc cgccggttcc cgtgagaatc ctgctggcaa tacccgatga gtttgcctcc       180
     ttttcctatg caagcctgat tcgagggcgg gaaacgcggc atcttttcgg cgcggaggcc       240
     caggccgctt ttaaaaacat gattgccccc gaattcatgg tgttcaagac gaggcgcgtc       300
     agcagcccgg cggccgcgat ggccatgctg tcccccggcg atccgaacaa cgcgcaaacg       360
     cgtgagttcg attacctggc gattcccagg ttcgcccgcg tgaatgtatc ggccagggga       420
     aggaagtacg gattcgacgt ggacatcctg gtcgacttcc acgccacgga cggcaggacg       480
     atcacaacga tcgaggggca cggggaatcc acaaccggcg ttcacttctc gatcagtccg       540
     caggaggcgg gcaacctggc cttgaggtgc tcgatggagg ccctcaggga cgcgatcatc       600
     ggccggaggg aactcttcgt tcccatccgg gcgcgcgttg agccgccccg ggaagaatcg       660
     tcgcgctcgg gtccgcaagc cgggcgcggt tcagcgccgc tccccgtaaa agttctcctg       720
     gccgttcccg acgagttcag ccggtatgct caccagatcg acccggggga aggcgggatc       780
     gaaaacgaca tcggcggcga ggcggagcgg cagttccgga tcatcctgtc tccgggattc       840
     gaaacactcg tgataaggcc gacagagagc gaatctgcgg ccatggaact gctttcctcc       900
     catagcccgg ccaacatcga cgcacgcgga ttcgattatg tcgccatacc ccggttcacc       960
     cggatcgact cacgggtcag gggctcgcat tacatgttct ccgcggagat acagttgcgg      1020
     ttctatcccg tgagcgggtt gagggaagtg accatcaaag gcctcggcaa gtatgaaggg      1080
     gacctggacg ggggtgccgc ggaggaggcg accggccgcg cgatcaaaac cgccgtcaag      1140
     gcgatccggg aaagcatcga ccaaaggcac gatctgtttc tcccctga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page