(data stored in ACNUC7421 zone)

EMBL: CP000478.PE171

CP000478.PE171       Location/Qualifiers
FT   CDS_pept        complement(209007..209669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0173"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; PFAM: ferredoxin; KEGG:
FT                   sth:STH2640 succinate dehydrogenase iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15875"
FT                   /db_xref="GOA:A0LEM3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEM3"
FT                   /protein_id="ABK15875.1"
FT                   /translation="MDVVLKISRFDPGMDTAPRFQRFVVGVEPNQTVLDALLCAWRQDI
FT                   GLSFRRSCRSAICGSCAVRINGRPALACQTLMEKAVAEGEPVTIEPLPHFKLLKDLVVD
FT                   LEPFFESLKAVVPWLILREDYGGRMSPEVARSLEHPATCILCGVCEADSETSETLHPAG
FT                   LVKALRLARDPRDALGAHRIRLLQVPVEVLRLFVRELPDKCPKGIEITDDILRRGVT"
     atggacgtcg tgctcaagat atcccggttc gatcccggca tggacaccgc tccccgtttc        60
     cagcgttttg tggtcggcgt cgagcccaac cagacggtgc ttgacgcgct gctgtgcgca       120
     tggcggcagg acatcggcct ctcgtttcgc cgttcctgcc gaagcgccat ttgcgggtcg       180
     tgtgccgtgc gcatcaacgg gcgaccggca ctggcctgcc agacgctgat ggaaaaggcc       240
     gtcgccgagg gtgagcccgt gaccatagaa ccgcttcctc atttcaagct cctcaaagac       300
     ctcgtggtgg acctggagcc gttcttcgag tcgctcaagg ccgtcgtgcc gtggctcatc       360
     cttcgggagg actacggcgg ccgcatgtct cccgaggtcg cgcggagcct ggaacatccc       420
     gcgacatgca ttctgtgcgg ggtgtgcgag gcggattccg agacttcgga aacccttcac       480
     ccggcaggtc tcgtgaaggc cttgcgcctg gcccgggacc ccagggacgc cctcggtgcg       540
     catcgtatcc ggctcctgca agtgccggtc gaggtcttga ggctgttcgt cagggaactc       600
     cccgacaaat gtccgaaggg aatcgaaatc acggacgaca ttctgaggcg cggcgttacg       660
     tag                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page