(data stored in ACNUC7421 zone)

EMBL: CP000478.PE174

CP000478.PE174       Location/Qualifiers
FT   CDS_pept        complement(212287..212691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15878"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEM6"
FT                   /protein_id="ABK15878.1"
FT                   /translation="MRIAAPGESCLSAASPYNSSRRSSMMTRWAVEDSAGAPHSSGRRR
FT                   AWCRRMNTRRHRHHVDCLMALVSPDVALRNGNIRFPGHSGKQAGNKRSRRSGGPSRGEV
FT                   FSREDGDPARLSRHSRLALSRPLHLPYKTA"
     gtgcggattg ccgcccccgg cgaatcgtgc ctttccgccg cctccccgta caattccagc        60
     cggcgttctt caatgatgac ccggtgggcg gttgaggatt ccgccggcgc acctcattcc       120
     tcagggcgac ggcgggcatg gtgtcgccgc atgaacaccc gccgccatcg tcatcacgtg       180
     gactgcctca tggccctggt gtcaccggac gtggctttgc gcaacgggaa tatccggttt       240
     cccggacatt ccggcaaaca ggcgggaaac aaacgctcgc gaagaagtgg gggaccctct       300
     cggggcgagg tgttttcacg ggaagacggg gacccggcga gactctcccg tcacagccgg       360
     cttgcgctgt cgcgaccgct gcatcttccg tacaagaccg catga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page