(data stored in ACNUC7421 zone)

EMBL: CP000478.PE177

CP000478.PE177       Location/Qualifiers
FT   CDS_pept        complement(215795..216802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0179"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility C-terminal
FT                   domain; KEGG: sat:SYN_01112 UDP-N-acetylglucosamine
FT                   4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15881"
FT                   /db_xref="GOA:A0LEM9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEM9"
FT                   /protein_id="ABK15881.1"
FT                   /translation="MNILVTGAAGFIGYHLAYRLLKDGNTVIGLDNVNDYYDVNLKRNR
FT                   LKRLAPFQSFAFLKLDLHDTAGIEAMFRENAFDAVVHLAAQAGVRHSLTHPHSYVESNL
FT                   TGFVNILEGCRHHRIKHLVFASSSSVYGANVVMPLSVHHNVDHPLSLYAATKKANELMA
FT                   HTYAHLFGVPCTGLRFFTVYGPWGRPDMALFLFTRAILAGEPIRIFNYGRMRRDFTYID
FT                   DIIEGVVRMIPAPPSPNPQWDRESSDPATSYAPYRVYNIGNNRPVELMEYVAAIESCLG
FT                   KEAQKEFLPLQPGDVPATCADVSDLERDFGFRPSTTIQEGITRFIEWYRAYYSV"
     atgaacatcc tggtcaccgg cgccgcgggc tttatcggat accacctggc atatcggctt        60
     ctcaaagacg gaaacaccgt aatcggtctg gacaatgtca acgattacta tgacgtcaac       120
     ctgaagcgga accgtttgaa acggcttgcg ccgtttcaaa gctttgcttt cctgaagctc       180
     gacctgcacg atacggcggg catcgaagcc atgttcaggg agaatgcctt cgatgccgtc       240
     gtgcacctgg ccgcccaggc cggtgtgagg cattcgctga cccatccgca ttcctacgtc       300
     gagagcaatc tcaccggctt cgtgaatatt ctcgaagggt gccgacacca ccggatcaag       360
     cacctcgtct tcgcttcgtc gagctcggtc tacggcgcca acgtcgtcat gcccttgtcg       420
     gtacaccaca acgtcgacca tcccctctcg ctctacgccg ccacaaaaaa agccaatgag       480
     ctcatggcac acacttacgc tcatcttttc ggcgtcccct gtaccgggct gcgcttcttc       540
     accgtttacg gcccctgggg gcgacccgac atggccctgt ttctcttcac ccgcgcgatc       600
     cttgcgggag agcccatcag gatattcaac tacggcagga tgcgacggga tttcacctat       660
     atcgacgaca ttatcgaggg cgtggtgaga atgatccccg cgcccccctc acccaacccg       720
     caatgggatc gcgaatcatc ggacccggcc acgagctacg ccccttaccg ggtgtacaac       780
     atcggcaaca accggcccgt ggagctgatg gagtacgtgg cggccatcga aagctgcctg       840
     gggaaggaag cacaaaagga attcctgccg ctccagccgg gggacgttcc ggcaacctgc       900
     gccgacgtca gcgacctgga gcgggatttc gggttccggc caagcaccac gattcaggaa       960
     ggaatcacgc ggttcatcga atggtacagg gcttactatt cggtgtaa                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page