(data stored in ACNUC7421 zone)

EMBL: CP000478.PE18

CP000478.PE18        Location/Qualifiers
FT   CDS_pept        complement(30557..31330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0019"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: sat:SYN_01176 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15722"
FT                   /db_xref="InterPro:IPR007161"
FT                   /db_xref="InterPro:IPR025251"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE70"
FT                   /protein_id="ABK15722.1"
FT                   /translation="MQLIRNLYDHFHEKAQKTKIACLCVGLSYTAVITDDGGMGIAYTY
FT                   AEDTHCCRMNRNYRDYEGERAIELLEEIRSPDALRRSMGLACVNAMNYHDASGFPEDST
FT                   DRLWMDSFGIGSGTRVAMVGFFRPLMKLFRDRGALVEALDDFQGIGDRDSFYGKLDGWA
FT                   EVLLLTSTSILNHTTEEILGRIAPEVKVVMLGPSTPMVADAFRHLPVRVLAGTVPVDKE
FT                   AVLRAVRHGAGTPVIHRFSRKAYVTLADGRVRAPC"
     atgcaactga tacggaatct ctacgatcac tttcatgaga aggcgcaaaa gacgaaaatc        60
     gcatgtcttt gcgtgggatt gagctacacg gccgtgatca ccgacgatgg cgggatgggg       120
     attgcctaca cctatgcgga ggatacgcat tgttgcagga tgaacaggaa ttaccgggat       180
     tacgagggcg aacgggccat cgaattgctg gaggaaatca ggagccccga tgccttgcga       240
     cgcagtatgg gactcgcctg cgtcaacgcc atgaactacc acgatgcgag cggatttccg       300
     gaggactcaa cggatcgtct ctggatggat tcgtttggca tcggctcggg aacccgagtc       360
     gcgatggtgg gcttcttccg gcctctcatg aagcttttca gggatcgtgg agcgttggtg       420
     gaagccctgg acgactttca gggcattgga gatcgggaca gcttttacgg gaaattggac       480
     ggatgggcgg aagtcctgct gctcacctcg acttccattt tgaatcacac cacggaagag       540
     attctcggcc gcattgcccc cgaagtgaag gtcgtcatgc tgggaccgag cacacccatg       600
     gtcgccgatg ccttccgcca cctgcccgtc cgggtgctgg cgggaaccgt tcccgtggac       660
     aaggaagccg tgctgagagc cgttcgccat ggggccggca cccccgtcat ccatcggttc       720
     agccgcaagg cctacgtgac tctggccgat gggcgggtgc gtgcgccttg ttag             774
//

If you have problems or comments...

PBIL Back to PBIL home page