(data stored in ACNUC7421 zone)

EMBL: CP000478.PE180

CP000478.PE180       Location/Qualifiers
FT   CDS_pept        complement(217845..218255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0182"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tko:TK1170 threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15884"
FT                   /db_xref="GOA:A0LEN2"
FT                   /db_xref="InterPro:IPR015011"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEN2"
FT                   /protein_id="ABK15884.1"
FT                   /translation="MKLLMFHAPEFWFKTFDKAIPDAPDCKEEKSFRQAVVIFYQVEGE
FT                   DVGREDGIVSKWVKNAKWIAGKFATRTVILHSFNHLSLSKAPPETAHRLAAQVRGRLER
FT                   AGFSVFETPFGYLNEWKLHVSGESLAKVFKEI"
     gtgaaactgc tgatgttcca tgccccggaa ttctggttca agacctttga taaggcgatt        60
     cccgacgctc cggactgcaa agaggaaaag tctttccggc aggccgtggt tatcttttac       120
     caagtcgaag gagaagacgt tggcagagag gacggaattg tttccaagtg ggtcaagaac       180
     gccaaatgga ttgcgggcaa gttcgcaacc agaaccgtca tccttcattc gttcaaccac       240
     ctttccctga gcaaggcgcc gccggagacg gcacatcgac tggccgcgca ggtccggggg       300
     cgcctggagc gcgcgggctt ctccgtgttc gaaaccccgt tcggttattt gaacgaatgg       360
     aaactccatg tctcgggtga atccctcgcc aaggtattca aagagatatg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page