(data stored in ACNUC7421 zone)

EMBL: CP000478.PE183

CP000478.PE183       Location/Qualifiers
FT   CDS_pept        219834..220838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0185"
FT                   /product="HflC protein"
FT                   /note="TIGRFAM: HflC protein; PFAM: band 7 protein; KEGG:
FT                   pca:Pcar_2263 probable lambda CII stability-governing
FT                   protein (HflC)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15887"
FT                   /db_xref="GOA:A0LEN5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEN5"
FT                   /protein_id="ABK15887.1"
FT                   /translation="MRQTESRGTDVISRKMSVVAVLAVVVGIVLYFSAYIVTETEQVVV
FT                   TQMGAPVGEPVTKAGLYFMTPFIQTANYFEKRIMKWDGSPNQIPTRDKKYIWVDITARW
FT                   RIKDPLLFLKRVGSVQLAHSRLDGILDSVVRDYVSNNDLIELVRSEGWEEAWQRLKEAG
FT                   IPDFQSTDPGAASEHLVKGREKITREMVADAAKLLPEFGIELHDIRIKRINYVESVQKK
FT                   VFDRMISERKRIAAQYRSEGEGERAAILGQMERELAKINSEAYRKSQELRGKADAETTR
FT                   IYAEAFNRNPEFYSFYRSLELYRDFNSSGSSFVLGTDADVFKYLKNGGKAAGR"
     atgagacaga ccgaaagccg gggaaccgat gtgatttcac gcaaaatgag cgttgtggcc        60
     gtcctggccg ttgttgtggg aatcgttctt tatttctccg cctacatcgt gaccgagacg       120
     gagcaggtgg tcgtcacgca gatgggtgcc cccgtggggg aacccgttac caaggcggga       180
     ttgtacttca tgaccccctt cattcagacg gcgaactatt tcgagaagcg gatcatgaag       240
     tgggacggca gtccgaatca gattcccacc cgggacaaaa agtacatctg ggtcgacatc       300
     accgcccgat ggcggatcaa ggatccgctc cttttcctca aacgtgtcgg atcggttcaa       360
     ctggctcaca gccgcctcga cgggatcctc gattccgtgg tcagggacta cgtctcgaac       420
     aatgacctga tcgagctggt tcggagcgaa ggttgggaag aagcctggca gcggcttaaa       480
     gaagccggaa tccccgattt tcaaagcacg gatccggggg cggcctccga acacctggtc       540
     aaggggcggg agaagatcac ccgggaaatg gtggccgatg ccgcgaagct gctgcccgag       600
     ttcggcatag agctgcacga tatccgcatc aagcggatca attacgtgga atcggtgcag       660
     aagaaggttt tcgaccgcat gatttccgag cgcaaacgga ttgcggccca gtaccggtcc       720
     gaaggcgagg gggaacgagc cgccattctc gggcaaatgg agcgggaact ggccaagatc       780
     aattcggaag cctaccgcaa atcgcaggaa ctccgcggga aggcggacgc cgagacaacc       840
     aggatatacg ccgaagcctt caaccggaat cctgaattct attcgttcta tcggtccctg       900
     gaactctaca gggatttcaa cagttccggc agctctttcg tactgggcac ggacgcggat       960
     gtgttcaaat atctgaagaa cggcggcaaa gctgcgggca ggtag                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page