(data stored in ACNUC7421 zone)

EMBL: CP000478.PE185

CP000478.PE185       Location/Qualifiers
FT   CDS_pept        222091..222459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0187"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   dde:Dde_3609 response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15889"
FT                   /db_xref="GOA:A0LEN7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEN7"
FT                   /protein_id="ABK15889.1"
FT                   /translation="MMPKILVVDDEEHIRLLYSEELKEVGYEVITAESGFKLLELIEQE
FT                   KPDLVILDIKMVDYNGLDLLQDIRNRFYDLPVILSTAYDTFKEDMKSIAADFYVVKSFD
FT                   LTELKQKIAMALETRLPT"
     atgatgccca aaatattggt cgtggatgac gaggagcaca ttcggctgtt gtattcggag        60
     gagttgaagg aggtcggtta cgaggtgatc acggccgaaa gcggtttcaa gctgctcgaa       120
     ttgatcgaac aggaaaagcc cgacttggtg atattggaca tcaagatggt cgattacaac       180
     ggcctggacc tgctgcagga cattcgtaac cgcttctatg acctgccggt gatcctgtcg       240
     accgcctacg atacgttcaa ggaagacatg aaatccatcg ccgccgattt ttacgtggtg       300
     aagagcttcg acctcacgga gttgaaacag aaaatcgcca tggcgctgga gacgcgcctg       360
     ccgacctga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page