(data stored in ACNUC7421 zone)

EMBL: CP000478.PE187

CP000478.PE187       Location/Qualifiers
FT   CDS_pept        complement(223747..225018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0189"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="PFAM: permease YjgP/YjgQ family protein; KEGG:
FT                   pca:Pcar_1922 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15891"
FT                   /db_xref="GOA:A0LEN9"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEN9"
FT                   /protein_id="ABK15891.1"
FT                   /translation="MQGRPIRDSGRGRPRNAKPAGGESRRETDDAIMKMTLYRYLIKEQ
FT                   MVPLGVCLMGVSLVLITGRLFQLLKVLFTSSFTLGDLMALVALAMPKLMLFALPMASLL
FT                   GVLLAFVRLNSDNELIALRAAGIGFHQFFPAVVSLLLGVTLISFVNMIFVIPPTGKAFE
FT                   VKLRSMARSGLPVLMKEGTFITAIPKLTFFFQSVNPTELSVRGIFVQDRREEKVRLAIV
FT                   AESARIVYQRDSNHLTFKIANGSITRVADDMKNAQAVSFKAYDLSLSLDELIGSARGSK
FT                   MNKREMTLRELYRVIVEKTGDVGHALEFHQRLAFPSGCLLLGLIGAPLGAVFRQRGRIA
FT                   GITIGLVVFLAYYVILSAGKGLGENHLVHPFLACWAPNLLCIAASFYLWRKMRLETPFK
FT                   TFQLLQEWASSWYRLRRARKGKKT"
     atgcagggca ggccaatccg cgattcgggc cggggccgcc cacggaacgc aaaaccggcc        60
     ggtggggaat cccggcggga aaccgacgac gccatcatga aaatgactct ataccggtat       120
     ttaatcaagg aacaaatggt tccgctcggc gtctgcctga tgggagtgag cctcgtcctg       180
     atcactggaa ggctctttca gctgctcaag gtcctcttca cgagttcctt caccctgggc       240
     gatctcatgg cgctggtcgc cctcgccatg cccaagctca tgcttttcgc cctccccatg       300
     gcctcattgc tcggcgttct gctcgccttc gtcaggctga acagcgacaa cgagctgatc       360
     gctctgcgcg cggccgggat cggtttccac cagttctttc cggcggtggt gtccctgctt       420
     cttggcgtga ccctgatttc cttcgtcaac atgatattcg tcatcccgcc gacgggcaag       480
     gctttcgagg tcaagctcag gagcatggcc cgatcgggtc tccctgttct gatgaaggaa       540
     ggaaccttca tcaccgccat ccccaaattg acctttttct tccagtccgt caatccgacc       600
     gaactgtccg ttcgcgggat cttcgtgcaa gaccggcggg aggaaaaagt gcgccttgcc       660
     atcgtcgccg aaagcgcccg gatcgtctat cagcgcgact cgaaccatct gacgttcaaa       720
     attgccaacg gcagcatcac tcgtgtggcc gatgacatga agaacgccca ggcggtgtct       780
     ttcaaagctt acgatctttc actctcgctc gatgaattga tcggttccgc acgcggatcg       840
     aaaatgaata aaagggagat gactttgcgg gagctctacc gggttatcgt ggaaaagacg       900
     ggcgacgtcg ggcatgccct cgaattccac caacggcttg cttttccttc gggctgcctg       960
     ctgctcggat tgatcggcgc gccgcttggg gcggttttcc gtcagcgggg ccgcattgcc      1020
     ggaataacca tcggtctggt cgtgttcctg gcctactacg tgatcctctc cgccggcaag      1080
     ggactgggcg agaatcacct ggtacaccct ttccttgcct gctgggctcc aaatctgctg      1140
     tgcatcgcgg catctttcta cctttggcga aaaatgcgac tggagactcc cttcaagact      1200
     tttcagctcc tgcaggaatg ggcgtcgtcg tggtatcggc tccgtagagc ccgcaaggga      1260
     aagaaaacgt ga                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page