(data stored in ACNUC7421 zone)

EMBL: CP000478.PE193

CP000478.PE193       Location/Qualifiers
FT   CDS_pept        231736..232056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0195"
FT                   /product="branched-chain amino acid transport"
FT                   /note="PFAM: branched-chain amino acid transport; KEGG:
FT                   sth:STH456 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15897"
FT                   /db_xref="GOA:A0LEP5"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEP5"
FT                   /protein_id="ABK15897.1"
FT                   /translation="MPETEYLLLVAGMGLVTYLLRWVPLFFFSRMVLPRGLVEWLDLIP
FT                   VSIMSALVFPDLLTSGAPKHLDLFQVKSIVAVPTLLFAFKTKSPGGTVLVGMLLYWLAG
FT                   RL"
     atgcctgaaa ccgaatacct cctcctggtt gccggcatgg gactggtgac ctacctgctt        60
     cgctgggtgc cgctcttctt cttctcgcga atggtcctgc cccgcgggct ggtggagtgg       120
     ctggacctga tcccggtttc catcatgagt gcgctggtct tcccggacct tctgacctcg       180
     ggggctccga aacatctcga tctcttccag gtgaaatcca tcgtggccgt tcccaccctg       240
     ctttttgctt tcaagacgaa gtccccggga ggaaccgtcc tggtcggcat gcttctgtac       300
     tggctggcgg ggagactttg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page