(data stored in ACNUC7421 zone)

EMBL: CP000478.PE196

CP000478.PE196       Location/Qualifiers
FT   CDS_pept        234595..234978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0199"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase,
FT                   chain 3"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase,
FT                   chain 3; KEGG: syd:Syncc9605_0203 NADH dehydrogenase alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15900"
FT                   /db_xref="GOA:A0LEP8"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEP8"
FT                   /protein_id="ABK15900.1"
FT                   /translation="MLPMQLKIDFLAVGLYLLAGIGFAVVPLIVSRLIVRRSRGARRDE
FT                   TYESGMETIGSAWIQFTVAYYIYALIFLAFDVDVLYLFPVALVYGKYGLRDLIEVMIFI
FT                   GILSLAIVYAWRKGVFEWKSRTE"
     atgcttccca tgcaattgaa gatcgatttt ctggctgttg ggctgtacct gctggcgggg        60
     atcggatttg ccgtggttcc gttgatcgtt tccaggctga tcgtcaggcg gagccgtggg       120
     gccaggcggg acgaaaccta tgaaagcggg atggagacga tcgggagcgc atggattcag       180
     ttcacggtcg cctactacat ttatgccttg atcttcctgg ccttcgacgt ggacgtgctc       240
     tacctgtttc cggtggcgct ggtgtacggc aagtacggcc tccgggacct gatcgaagtg       300
     atgatattca taggcatttt atcgcttgcg atcgtttacg cctggcgcaa aggagtgttc       360
     gagtggaaga gcagaaccga gtag                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page