(data stored in ACNUC7421 zone)

EMBL: CP000478.PE197

CP000478.PE197       Location/Qualifiers
FT   CDS_pept        234957..235487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0200"
FT                   /product="NADH-quinone oxidoreductase, B subunit"
FT                   /EC_number="1.6.99.3"
FT                   /note="KEGG: mta:Moth_0978 NADH-quinone oxidoreductase, B
FT                   subunit; TIGRFAM: NADH-quinone oxidoreductase, B subunit;
FT                   PFAM: NADH ubiquinone oxidoreductase, 20 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15901"
FT                   /db_xref="GOA:A0LEP9"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEP9"
FT                   /protein_id="ABK15901.1"
FT                   /translation="MEEQNRVAPEEPAIQFAVLEDILNLARANSLWPMTFGLACCAIEM
FT                   MAAGASRFDLDRFGAGVFRPSPRQSDLMIVAGTISKKMGPAVQMLWDQMPNPKWCIAMG
FT                   NCAISGGPFEYEGQYAIVPGAHLIVPVDIFIPGCPPRPEALIQGFLALGDKITGGEHRN
FT                   YLRRFHRRGGTRK"
     gtggaagagc agaaccgagt agcaccggaa gagccggcca tccaattcgc cgttctggaa        60
     gatatcctca atctggcgag agccaactct ctgtggccca tgactttcgg cctggcgtgc       120
     tgtgccatcg agatgatggc cgccggggct tcccgttttg acctggatcg tttcggagcg       180
     ggtgttttcc ggccttcacc ccgccaatcc gacttgatga tcgtggcggg aacgatctcc       240
     aagaagatgg ggccggccgt tcagatgctg tgggatcaga tgcccaaccc caagtggtgc       300
     atcgccatgg gcaactgtgc catctccgga gggccgttcg agtacgaagg gcagtacgcc       360
     atcgttcccg gcgcccatct gatcgtaccg gtggacattt tcattcccgg gtgtccgcct       420
     cggccggagg cgctcattca ggggtttttg gccttggggg acaagataac cgggggcgag       480
     cacagaaact acctgagacg atttcatcgc cgtggaggaa cgaggaagtg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page