(data stored in ACNUC7421 zone)

EMBL: CP000478.PE198

CP000478.PE198       Location/Qualifiers
FT   CDS_pept        235487..235960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0201"
FT                   /product="NADH dehydrogenase (ubiquinone), 30 kDa subunit"
FT                   /note="PFAM: NADH dehydrogenase (ubiquinone), 30 kDa
FT                   subunit; KEGG: dps:DP1319 probable NADH dehydrogenase,
FT                   subunit 9"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15902"
FT                   /db_xref="GOA:A0LEQ0"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEQ0"
FT                   /protein_id="ABK15902.1"
FT                   /translation="MSKTADFCGELRGILGGEAISADDGYRTGVAFSVRVPMERLQEVA
FT                   AACNAGGFYLETITALDFKDTKELVYHFNCYEPGSRFALRVLCGHDQTPPTISTIFASA
FT                   GWLEREVHEFFGIQFAGSFDLRPLLLPEDAEFHPLRKTFGIVAAYRKRDEIYA"
     atgtccaaga cagccgattt ttgcggggaa ttgcgtggta ttttgggcgg cgaggcgatt        60
     tctgcggacg acgggtaccg gaccggggtc gctttttccg tgagggttcc gatggaacgg       120
     cttcaggagg tcgcggcggc ctgcaacgcc ggcggattct acctggaaac gatcaccgcc       180
     ctcgatttca aggacaccaa ggaactcgtc taccacttca actgctacga acccgggtcc       240
     cgtttcgccc tgcgggtcct gtgcggccat gaccaaaccc ctccgacgat cagcacgatt       300
     ttcgcctccg ccggatggct ggaacgggaa gtccatgaat tcttcggcat ccagttcgcc       360
     ggcagcttcg atctcaggcc gctcctgctg cctgaggacg cggaattcca tccgctcagg       420
     aagaccttcg gcattgtagc cgcctatcgc aaacgggatg aaatctatgc ctaa             474
//

If you have problems or comments...

PBIL Back to PBIL home page