(data stored in ACNUC7421 zone)

EMBL: CP000478.PE199

CP000478.PE199       Location/Qualifiers
FT   CDS_pept        235953..237074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0202"
FT                   /product="NADH dehydrogenase (ubiquinone)"
FT                   /EC_number="7.1.1.2"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase, chain 49kDa;
FT                   KEGG: dps:DP1318 probable NADH dehydrogenase, subunit 7"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15903"
FT                   /db_xref="GOA:A0LEQ1"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEQ1"
FT                   /protein_id="ABK15903.1"
FT                   /translation="MPKRFLAPVTEQIYTLNLGPQHPSTHGVLRVLLDLDGEFIVKADP
FT                   VIGYGHRGHEKMGENRLFKQFLPNTSRLDYLSGFLFNHGYVLAVEKLAGIPVPPRAQFI
FT                   RTICSEFNRIASHLLWFGTYVMDLGGFTPFLYAFDDRERILDILDWVTGSRLTYSYCRF
FT                   GGVDRDIDTRFTDMARDFIKRLRSRWPDYHNLVTRNIIFIHRTRGVGVITPEQARQFGV
FT                   TGPNLRACGIAFDTRKAEPYEVYDQFDFEIPVGSDGDALDRYRVRFEEMEQSLRIIEQA
FT                   LDRLPGGPFMNDSVPTRLKPPKGEVYFAFESARGQAAYYLVSDGTPSPYRCHIRVPSFG
FT                   NLHVLTEVLRGTLVADAISILGSVDLVIPEIDR"
     atgcctaaac gtttcctagc ccccgttacc gaacagattt acaccctcaa tcttggcccc        60
     cagcacccga gcacgcatgg cgtgctcagg gttttgctcg atcttgacgg ggaattcatc       120
     gtcaaggccg atccggtgat cggctacggc caccgcgggc acgagaagat gggggaaaac       180
     cgtctcttca agcaatttct gcccaacacc agccggctcg attacctttc ggggtttctc       240
     ttcaaccacg gatatgttct ggcggtggag aagctggccg gcattccggt tcccccccgg       300
     gcgcagttca tccgcacgat ctgttccgag ttcaaccgga tcgccagcca cctgctctgg       360
     ttcgggacct acgtcatgga cctgggcggg ttcaccccgt ttctgtacgc tttcgacgac       420
     cgggaacgga tcctggatat cctcgactgg gtgaccggct cgcggctcac ctattcgtac       480
     tgccggttcg gcggcgtgga ccgggacatc gacacccgct tcacggacat ggcgagggat       540
     ttcatcaagc ggctgcgcag ccggtggccc gactatcaca atctggtcac caggaacatc       600
     attttcattc atcgcaccag gggcgtaggg gtgatcaccc ccgagcaggc acggcaattc       660
     ggagtgacgg gccccaatct gcgcgcctgc ggcattgcgt tcgacacgcg caaggccgaa       720
     ccttacgaag tgtacgacca gttcgacttc gaaatcccgg tcggttccga tggcgatgca       780
     ctcgaccggt acagggtccg gttcgaagag atggagcaga gcctgcggat catcgaacag       840
     gccctcgatc gactgccggg cggtccgttc atgaacgatt cggttcccac ccggttgaag       900
     ccgcccaaag gggaagtcta cttcgcattc gagagcgcgc gggggcaggc tgcttactac       960
     ctggtgagcg acggtacccc cagcccgtac cggtgtcata tccgcgtgcc gagctttggc      1020
     aatctccacg tgctcacgga agttttgcgc gggactctgg tggcggatgc catctcgatc      1080
     ctgggcagcg tggacctggt gatccccgag atcgaccgat ag                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page