(data stored in ACNUC7421 zone)

EMBL: CP000478.PE200

CP000478.PE200       Location/Qualifiers
FT   CDS_pept        237139..238128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0203"
FT                   /product="respiratory-chain NADH dehydrogenase, subunit 1"
FT                   /note="PFAM: respiratory-chain NADH dehydrogenase, subunit
FT                   1; KEGG: mta:Moth_0981 respiratory-chain NADH
FT                   dehydrogenase, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15904"
FT                   /db_xref="GOA:A0LEQ2"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEQ2"
FT                   /protein_id="ABK15904.1"
FT                   /translation="MGHEGGTEWVRLIVGLVIILAFSQLNALFLVWLERKVAGRIQLRP
FT                   GPMEVGPHGLLQTIMDGIKLVGKELITPRSVDRKLFILAPVLVFMPVLVGFLVLPFGPG
FT                   LILRDMNVGILLIFSFSTFTVLAILAGGWASNNKYALLGAIRSVGQNVAYEIPLLLTVM
FT                   SVVLMVNSMRFSEIVAAQGRVWFIFLQPVAGLLYLICATAETNRAPFDIPEAESELVAG
FT                   FHTEYTGMRFGLFFLAEYTNMFIVTAVATSLFFGGWHGPFGFDFGLPGVVWFLIKTYVL
FT                   IFVIMWVRWTFPRIRFDQLMNFSWKFLIPVSLVNLVVTAVVLKLIDLN"
     atgggacatg aaggtggaac ggagtgggtg cggctgatcg tgggcctcgt gatcatcctg        60
     gctttttctc agctcaatgc cctgtttctg gtctggctgg aacggaaagt ggctgggcgc       120
     atccaactca ggccgggccc catggaggtc ggtccgcacg gcctgctgca aacgatcatg       180
     gacggcatca agctggtcgg caaggagttg atcactccgc ggtcggtgga caggaagctc       240
     ttcatcttgg cgccggtcct ggtcttcatg ccggtcctgg tgggattcct cgtgcttcct       300
     ttcggacccg ggctgatcct gcgcgacatg aacgtcggca tcctcctgat tttctccttt       360
     tcgaccttca ccgtgctggc cattcttgcc ggcggatggg cttccaacaa caagtacgct       420
     ctgctcggcg cgatccggtc ggtggggcag aacgtcgcct acgaaattcc cctgttgttg       480
     acggtcatga gtgtcgtgct gatggtgaat tccatgcgtt tctcggaaat cgtggcagcg       540
     caggggcgtg tctggttcat tttcctgcaa cccgtggcgg ggttgctcta cctgatttgc       600
     gcgaccgcgg agaccaaccg cgcgccgttc gacatccccg aagccgaatc cgagctcgtg       660
     gcgggtttcc acaccgagta caccgggatg cggttcgggc tcttcttcct ggcggaatac       720
     acgaacatgt tcattgtcac cgccgttgcc accagcctgt tcttcggcgg gtggcacggc       780
     ccgttcggct tcgacttcgg gcttcccggg gtggtgtggt tcctgatcaa gacttacgtg       840
     ctcattttcg tgatcatgtg ggtgcgctgg acttttccca ggatccgctt cgaccagctc       900
     atgaatttct cctggaaatt cctgattccg gtgagtctcg tgaacctggt cgtgactgcc       960
     gtggtcctga aactgattga tctgaactga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page