(data stored in ACNUC7421 zone)

EMBL: CP000478.PE206

CP000478.PE206       Location/Qualifiers
FT   CDS_pept        242973..244394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0209"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain N"
FT                   /EC_number="1.6.5.11"
FT                   /note="KEGG: dps:DP1309 probable NADH dehydrogenase,
FT                   subunit 2; TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain N; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15910"
FT                   /db_xref="GOA:A0LEQ8"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEQ8"
FT                   /protein_id="ABK15910.1"
FT                   /translation="MMKWVLFIPELYYLLMAVVFFACSLSRRLQSGVLYRWAVILAGGG
FT                   LLATVLAVNQNGFIFFDCYRVDLYSQLFKILLALGTFWVIFSCSELQGIDSRYHAEFFL
FT                   LTTVCTLGMMMLVSANELLTVYVSIELSSYSLYLLVPMRKQTEIYVETGIKYFMIGVTA
FT                   SAFMLFGISFIFGVAHTTYVPDLVKTLPSLIKEPAAIIGLVLTLCGFFFKQALFPFHSW
FT                   APDVYMGAANQVTTYIATASKMAAAAMVIRFVNLSGGESPLFTQVLVGLAVLSMTFGNL
FT                   VAIIQKDLKRLLAYSSIAHAGYMMIGILTMSEHGVASAIYYSAAYLVMNFACFMVIMKV
FT                   ADDGRNLQIKELAGLHKRSPLLAMTLMLGLFGLAGIPPTVGFTGKFLVFAAALRKGYLI
FT                   LVIIGMINATISLYYYLIVIKAAYLLEPERPYPDVRVDTWTRALSYGLIVLMIYLGVFP
FT                   DQFVALTEAAARSLP"
     atgatgaaat gggtcctttt tatacctgag ctgtattacc tgttgatggc ggtggtcttc        60
     ttcgcctgtt cgctgagcag aaggctgcag tcgggcgtcc tttaccgatg ggcggtcatc       120
     ctggccggcg gcggcctcct ggcgacagtc ctggcggtca accagaacgg gttcatcttc       180
     ttcgattgct acagggtcga cctttacagc cagctgttca agatcctgct ggcactgggt       240
     accttctggg tgatcttttc ctgcagcgag cttcagggga tcgactcgcg ctaccacgcc       300
     gaattctttc tgctgaccac ggtatgcacg ctcggcatga tgatgctcgt cagcgccaac       360
     gaactgctca cggtctacgt ctccatcgaa ctctcctcct actcgctcta ccttcttgtg       420
     cccatgcgca aacagacgga aatatacgtc gagacgggaa tcaagtattt catgatcggc       480
     gtcaccgcgt ccgccttcat gctgttcggc atcagcttca tcttcggcgt ggcgcatacc       540
     acctacgtgc ccgacctggt gaaaacgctt ccctccctga tcaaggaacc tgccgccatt       600
     atcgggctcg ttttgaccct gtgcggtttc ttcttcaaac aggccctctt tccgtttcac       660
     agttgggcgc ccgacgtcta catgggggct gccaaccagg tgaccacata catcgccacg       720
     gcttcgaaaa tggccgccgc ggccatggtg attcgattcg tcaatctgtc cgggggagag       780
     agccccctgt tcacgcaggt cctggtgggc ctggcggtgc tgtcgatgac tttcgggaat       840
     ctggtggcca ttatccagaa ggatttgaaa cgtctcctgg cctactccag cattgcgcac       900
     gccgggtaca tgatgatcgg cattctgacc atgagcgagc acggcgtggc gagcgcgatt       960
     tactactcag cagcgtatct ggtgatgaac ttcgcctgct tcatggtgat catgaaagtg      1020
     gccgatgacg gacggaacct gcagatcaag gaactggcgg gactgcacaa gcgttccccc      1080
     ctcctcgcaa tgaccctgat gcttggcttg ttcggccttg cgggcatccc gcccacggtg      1140
     ggcttcacag gaaaattcct ggtgtttgcc gccgccctcc gcaaaggtta cctgattctg      1200
     gtcattatcg ggatgatcaa cgccaccatt tcgttgtatt attatctgat cgtgatcaag      1260
     gccgcttatc ttctggaacc ggagcggccg tatccggatg tccgggtgga cacatggacc      1320
     cgagccctga gttacgggct gatcgtcctc atgatctatc tgggagtgtt tcccgaccag      1380
     ttcgtcgctc tgacggaggc ggcggcacgg agtctgccct ag                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page