(data stored in ACNUC7421 zone)

EMBL: CP000478.PE209

CP000478.PE209       Location/Qualifiers
FT   CDS_pept        247920..249080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0212"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: gme:Gmet_0890 smf protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15913"
FT                   /db_xref="GOA:A0LER1"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:A0LER1"
FT                   /protein_id="ABK15913.1"
FT                   /translation="MDTPHGASSGESDRIAWLALRLVPDLGNRSVLRLINRFGSPRAVL
FT                   DAEPKELATVEGLRGKAISALQRKEFLRHPETEWETLQRKGVKLLALNDPEYPSNLSAI
FT                   PDPPAVLFVRGELQPRDLVAVAVVGSRAASPMGMIFTEKLSGELALNGVTIVSGFAVGI
FT                   DSAAHRGAIKAGGRTIAVLGCGLDIDYPYGQGGLRDEIAASGALVTEFPLGTPPVAGHF
FT                   PQRNRIISGLSLGVVVVEAAHRSGSLITARLALEQGREVFAVPGMAHHYRSVGPHRLLR
FT                   EGAKLVEGAEDVLEELRPLIRRSAAPPGEPDERETPVSGLEPDELQALRELDGNPRHID
FT                   EIARSTQWPVGKVMAVLSNLELKGVARQLPGKYFVHTWKQTCRKSK"
     atggacacgc cgcatggagc atcttccggt gagagtgaca ggattgcctg gttggcgttg        60
     aggctcgttc ccgacctggg gaatcgctcc gtgttgcggc tgatcaatcg tttcgggtct       120
     ccgcgggcgg tgctcgacgc ggagccgaag gagctcgcaa cggtggaggg gctgcgggga       180
     aaggcgattt cagccctgca aaggaaggag tttcttcgcc atccggaaac cgaatgggag       240
     acgctacaac ggaaaggcgt caagcttctg gctctgaacg atccggagta cccgtccaat       300
     ctttcggcca ttcccgatcc gcctgccgtg ttgttcgtgc ggggggagct ccaaccgagg       360
     gacctggttg cggttgccgt ggtgggttcg agggcggcat cccccatggg aatgatcttc       420
     acggagaaac tgagcggtga gcttgccctc aatggcgtga cgattgtgag cgggttcgcc       480
     gtcggcatcg acagcgcggc ccatcgcggg gcgatcaagg ccgggggccg caccatcgcc       540
     gtgttggggt gcgggctcga catcgattat ccatacgggc agggcggcct gcgggacgag       600
     attgcggcgt ccggggcgct cgtcaccgaa ttcccgctgg ggactcctcc ggtcgccggg       660
     cactttcccc agcgaaatcg gatcatcagc ggcctgtcac tgggagtggt ggtcgtcgaa       720
     gcggcgcatc ggagcggatc gctcatcacg gcgaggctgg ccctggagca gggaagagag       780
     gtttttgcgg ttccgggaat ggcccatcat tatcggagtg tcggacctca ccggctgctc       840
     agagagggag cgaagctggt ggaaggcgcc gaagacgtat tggaggagtt gcgcccgttg       900
     attcgacgga gcgctgcacc gcccggcgag cccgatgaac gggaaacgcc ggtatccggg       960
     ttggagccgg acgagcttca ggctcttcgg gagctggacg ggaatccgag gcatatcgac      1020
     gagattgccc gttcgacgca atggccggtc ggaaaagtca tggccgtgtt gtcgaatctt      1080
     gagctcaaag gggttgcgcg gcaactgccc gggaaatatt ttgttcatac ttggaaacag      1140
     acttgccgaa agagtaagtg a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page