(data stored in ACNUC7421 zone)

EMBL: CP000478.PE210

CP000478.PE210       Location/Qualifiers
FT   CDS_pept        249092..251395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0213"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.6.2.2"
FT                   /note="KEGG: sat:SYN_02798 DNA topoisomerase I; TIGRFAM:
FT                   DNA topoisomerase I; PFAM: TOPRIM domain protein; DNA
FT                   topoisomerase, type IA, central domain protein; DNA
FT                   topoisomerase, type IA, zn finger domain protein; SMART:
FT                   DNA topoisomerase I, ATP-binding; DNA topoisomerase I,
FT                   DNA-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15914"
FT                   /db_xref="GOA:A0LER2"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:A0LER2"
FT                   /protein_id="ABK15914.1"
FT                   /translation="MSKSLLIVESPTKAKTLGRYLGKDFIVKASVGHVKDLPKNRLGIN
FT                   LEKDFQPEYQVIRGKKKVISELHEAAAKSGAIFLGPDPDREGEAIAWHIAEEIGATDKP
FT                   VYRVLFYELTRKAIQEALAKPDRLNRELYEAQQARRILDRLVGYMISPILWQKVKRGLS
FT                   AGRVQSVALRLICAREKEIRDFDSREYWTITALLGTQASADAPAKSASRRFKAELFRCG
FT                   KKKCTISTGEEARELVDRLRPLDYRVSKVERRKKKRHPAPPFITSTLQQEAARKLHFSA
FT                   RQTMNVAQRLYEGLELGKEGAVGLITYMRTDSTRLSADAVQAVRDYIAGHWDKAYLPAK
FT                   PAAYKSKAGAQGAHEAIRPTDVNRTPETVAGFLTKEQLKLYTLIWKRFTACQMAPAVLD
FT                   QTSVDIAAGDYVLRASGSIVEFPGFMTLYVEGRENGDEDSETEGLLPELKEGEVLRLED
FT                   LKADQHFTQPPPRYTEASLIKELEDLGIGRPSTYATILSTILDREYAVVRKKSLFPSEL
FT                   GWLIDGLMVENFPSVVDVDFTAKMEKSLDEIEQGQHPYRNLLAEFYEQFSKTLESARTN
FT                   MVNLKAVGRRTDLQCPQCGLPLHIRWSRNGPFLACSGYPDCRFSSDYRRDEKGNIEPVA
FT                   EESTGETCEKCGRPMILKKGRFGNFLACSGYPACKNTKAPGTGIPCPREGCSGELVERV
FT                   SRGGRHFFGCSRYPECKTAFSGRPVPGKCPSCGTGPLIEKGGKGGSVKRVCVNPSCKYV
FT                   ETVPAAADRKAAKD"
     atgtctaagt cattattgat tgtcgaatcc ccgacaaaag cgaagacact tgggagatac        60
     cttggaaaag atttcattgt aaaagcctct gtggggcatg tgaaggatct tcccaagaac       120
     aggctcggaa tcaatctgga aaaggatttc cagccggaat accaggtaat acgcggcaag       180
     aagaaggtca tcagcgaact gcacgaggcc gccgcaaagt cgggagcgat ctttctcggt       240
     ccggaccccg accgcgaggg tgaggccatt gcgtggcata tcgcggaaga aatcggtgcc       300
     acggacaagc ccgtataccg ggtgcttttc tacgagctga cccggaaagc gatacaggaa       360
     gctcttgcca agcccgacag gctgaaccgg gagctctacg aagcccagca ggccaggcgc       420
     attctggacc gcctggtagg atatatgatt tccccgatcc tgtggcagaa agtgaagcga       480
     gggttgagcg ccgggagggt gcagtcggtg gcccttcggt tgatctgcgc gcgggaaaag       540
     gagatccggg atttcgattc cagggagtac tggaccataa ccgctttgct ggggacgcag       600
     gcatcggccg atgcgcccgc gaagagcgcg tcccggcggt tcaaggcgga gctgttccgt       660
     tgcgggaaga agaaatgcac gatttccacg ggagaggaag cccgcgagct ggtagaccgg       720
     ctgcggccgc tcgactatcg ggtgagcaag gtcgaacgca ggaagaagaa acgccatccg       780
     gcgcctccct tcatcaccag cacgctgcag caggaggcgg ccaggaagct gcatttctct       840
     gccaggcaga ccatgaatgt ggcccagcgg ctctacgagg ggctcgaact gggaaaggaa       900
     ggggccgtcg gcctgatcac gtacatgcgt accgactcga cacggctgtc cgcggatgcc       960
     gttcaggcgg tccgggacta catcgccgga cattgggaca aggcctatct gccggccaag      1020
     cccgccgcgt acaagagcaa agcgggcgcc cagggagcgc acgaggcgat ccggcccacg      1080
     gacgtgaatc ggaccccgga aaccgttgcg ggctttctga caaaagagca gctcaagctc      1140
     tatacgctca tctggaaacg tttcacggca tgccagatgg cgcctgccgt tctcgaccag      1200
     acctcggtgg atatcgcggc cggggactac gtcttgcgtg cgtccggctc gatcgtcgag      1260
     tttccgggtt tcatgacgct gtatgtcgag ggtcgggaga acggggatga ggattcggag      1320
     accgaggggc tgctgcccga gctgaaggaa ggggaggtcc tgaggctgga agacctgaag      1380
     gcagatcagc atttcaccca gcctccgccg cggtataccg aagcctccct gatcaaggag      1440
     ctcgaagatc tcggcatcgg gcggcccagc acttatgcca cgatcctttc gacgatcctg      1500
     gatcgggaat atgccgtggt ccgtaagaag agcctcttcc ccagcgaatt gggatggctg      1560
     atcgacggcc tgatggtgga aaacttcccc agcgtggtgg acgtcgattt taccgccaaa      1620
     atggaaaaaa gcctggacga aatcgaacag gggcagcacc cttatcgcaa ccttttggcg      1680
     gaattttacg agcagttttc gaagacgctc gaatccgcgc ggaccaacat ggtgaacctc      1740
     aaggcggtcg gacgccggac cgatctccag tgcccgcagt gcggcctgcc gctgcacatc      1800
     cggtggagtc gcaacgggcc gttcctggcc tgcagcggct atccggactg ccggttctcg      1860
     tcggactaca ggcgggatga aaagggaaac atcgagccgg tggccgagga atccaccggc      1920
     gagacgtgtg agaagtgcgg gcgaccgatg atcctgaaga aggggcgttt cgggaacttc      1980
     ctggcttgca gcggctatcc ggcgtgcaag aacaccaagg cgcccggtac gggaatcccg      2040
     tgtccgcgcg aaggatgttc gggggagttg gtggaacggg tcagcagagg cggccggcat      2100
     ttcttcggct gcagcagata tccggaatgc aagacggcct tttcggggcg gccggtcccg      2160
     gggaaatgcc cttcatgcgg caccgggccg ttgattgaaa aggggggcaa gggagggagt      2220
     gtgaagcggg tctgcgtcaa tccgtcctgc aagtatgtgg aaaccgttcc cgccgcggcg      2280
     gaccggaagg ccgcaaagga ttga                                             2304
//

If you have problems or comments...

PBIL Back to PBIL home page